DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and lsg1

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_997807.1 Gene:lsg1 / 323464 ZFINID:ZDB-GENE-030131-2184 Length:640 Species:Danio rerio


Alignment Length:510 Identity:152/510 - (29%)
Similarity:224/510 - (43%) Gaps:117/510 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ARGGNRNKNVNRYNLQFYQEGKKELEQMKQEGFKPFEKLSPAQREVDDRYFAGCDFPVRPPWTLT 121
            ||.|..:...:|...:.::|.|:.|.                             .|.||||..:
Zfish    88 ARAGLLSSEESRRLKKLHEENKQLLR-----------------------------IPRRPPWDES 123

  Fly   122 ESKEELDRTENRYFKEYVDELQKKQRAGDSKELSL--FELNLETWRQLWRVLEFSDILLIIVDVR 184
            .|.|.|.:||...|..:..:|   .|..:.::|.|  ||.||:.|||||||:|.||:::.|||.|
Zfish   124 TSPEVLQQTEKDSFLTWRRDL---ARLEEEQKLILTPFERNLDFWRQLWRVIERSDVVVQIVDAR 185

  Fly   185 YATLMFPPSLYDYIIN-TLKKHAIVVFNKVDLVEPHAVVAWRQYFRDRYPQLPVVLFASFLPRSR 248
            ...|...|.|..|:.. ::.|..:::.||.||:......||.:||:..  .:..|.:::.....|
Zfish   186 NPLLFRCPDLEKYVKEVSVHKVNMLLLNKADLLTREQRRAWARYFQKE--GIRAVFWSALAEAQR 248

  Fly   249 -KGSQRGPQA--------------------HRRSMEGVYNIYK---ECQRYVQGE-----VDLTT 284
             :..:||..|                    |........|..|   |.....:||     ||.:.
Zfish   249 LEAEERGEDAMDQEDQSDTEEETASKNATDHHEENSSSPNEEKDENEQDEEEEGEDERICVDESE 313

  Fly   285 WEQKIREDMRSDQLDILDEISTAVEG------------ELKISSSIDTTPHEHVKYHSGVLTIGC 337
            |:....|....|..:...| |||...            .|::..|:.:.|    ....|.:|:|.
Zfish   314 WQTCSEESGDEDHAEENPE-STATSSFYNSSRLLRKNELLEMFKSVHSGP----TCKDGQITVGL 373

  Fly   338 IGFPNVGKSSLINALKGRKVVSVSRTPGHTKHFQTIFLTPLVRLCDCPGLVFPS--STPKSLQVL 400
            :|:|||||||.||.:...|.||||.||||||||||:|:.|.:.||||||||.||  || |:..:.
Zfish   374 VGYPNVGKSSTINTIFRNKKVSVSATPGHTKHFQTLFVEPGLCLCDCPGLVMPSFVST-KAEMIC 437

  Fly   401 LGSFPISQLA--VPYRSLKFLGEHLNLPQ----------LLRLHLPED------YDEWSAVAISD 447
            .|..||.|:.  ||..||..    .|:|:          ::|....||      |:|     :..
Zfish   438 SGILPIDQMRDHVPAISLVC----QNIPRNVLEGTYGINIIRPREDEDPDRPPTYEE-----LLM 493

  Fly   448 AWAYKRGFLTAKAARPDRYRAANHILRMCLAGQQMLVLQFYPPGFEERREHWLQH 502
            |:.|.|||:||. .:||:.|:|.::|:..::|:   :|..:||......:...||
Zfish   494 AYGYMRGFMTAH-GQPDQSRSARYVLKDYVSGK---LLYCHPPPHINPEDFQPQH 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 88/268 (33%)
GTPase_YlqF 165..474 CDD:274669 118/370 (32%)
lsg1NP_997807.1 RbgA 152..534 CDD:224083 130/402 (32%)
HSR1_MMR1 164..426 CDD:206750 88/268 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..341 18/90 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 602..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55394
OrthoDB 1 1.010 - - D206558at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.