DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and Noa1

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006250907.1 Gene:Noa1 / 289562 RGDID:1359460 Length:694 Species:Rattus norvegicus


Alignment Length:407 Identity:88/407 - (21%)
Similarity:132/407 - (32%) Gaps:160/407 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PPWTLTESKEELDRTENRY-FKEYVDELQKKQRAGDSKEL-SLFELNLETWRQ--------LWRV 170
            |..|.||..||...||.|: |.|||.|...:::..:.:|| .|.:|..|..||        |.:.
  Rat    53 PSSTATEDCEEGTDTEERFLFPEYVPERTPEEQLRELRELRELQQLQQEKERQRLQRREERLQQK 117

  Fly   171 LEFSDILLIIVDVRYATLMFPPS-----------------LYDYIINTLKKHAI--------VVF 210
            |......|.:.::..|::  |||                 |..|:.....:.|.        .|.
  Rat   118 LRAGLRALPVPELPDASV--PPSGIYCSGCGAELHCQHPGLPGYLPGEKFRDAAQAEGGLARTVC 180

  Fly   211 NKVDLVEPHAVVAWRQYFRDRYPQL----------PVVLFA--------SFLPRSRKGSQRGPQA 257
            .:..|:..|......|..||:|.:|          .:||:.        :.||...|  ..||: 
  Rat   181 QRCWLLVHHRRALRLQVSRDQYLELVSTALQRPGPALVLYMVDLLDLPDALLPDLPK--LVGPK- 242

  Fly   258 HRRSMEGVYNIYKECQRYVQG-EVDLTTWE-----QKIREDMRSDQL------------------ 298
                           |.:|.| :|||...:     |::|:.:.:|.:                  
  Rat   243 ---------------QLFVLGNKVDLLPQDAPGYLQRLRKRLWNDCIRAGLVVAPGHRGPQYPTG 292

  Fly   299 -DILDEIS---------TAVEGELKISSSIDTTPHEHV-------KYHSGVLTIGCIGFPNVGKS 346
             :.||||.         |.|:....||:.......|.:       :|...|..:|.   .|.|||
  Rat   293 NEPLDEIKNQNPSSRSRTVVKDVRLISAKTGYGVEELISALQRSWRYRGDVYLVGT---TNAGKS 354

  Fly   347 SLINAL--------KGRKVV---SVSRTPGHTKHFQTIFLTPLVRLCDCPGLVFPSSTPKSLQVL 400
            :|.|.|        ||.:.:   ::|..||.|.:.                |.||...|      
  Rat   355 TLFNTLLESDYCTAKGSEAIDRATISPWPGTTLNL----------------LKFPICNP------ 397

  Fly   401 LGSFPISQLAVPYRSLK 417
                      .|||..|
  Rat   398 ----------TPYRMFK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 62/329 (19%)
GTPase_YlqF 165..474 CDD:274669 69/356 (19%)
Noa1XP_006250907.1 PRK13796 140..656 CDD:237511 60/318 (19%)
YqeH 180..396 CDD:206748 51/252 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.