DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and Mtg1

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006230646.1 Gene:Mtg1 / 100910751 RGDID:6497155 Length:331 Species:Rattus norvegicus


Alignment Length:261 Identity:70/261 - (26%)
Similarity:100/261 - (38%) Gaps:58/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 VQGEVDLT--TWEQKIREDMRSDQLD-------ILDE-ISTAVEGELKISSSIDTTPHEHVKYHS 330
            |..::||.  |.:|||.:.:....|.       |.|| |...:.   |::..|..:    .:||.
  Rat    80 VLNKMDLADLTEQQKIVQHLEEKGLRNVIFTNCIKDENIKQIIP---KVTELIGCS----YRYHR 137

  Fly   331 GVLTIGCI---GFPNVGKSSLINALKGR-----KVVSVSRTPGHTKHFQT---IFLTPLVRLCDC 384
            ......||   |.||||||||||:|:.:     |...|...||.|:...:   :...||:.|.|.
  Rat   138 AENPEYCIMVVGVPNVGKSSLINSLRRQHLRTGKAARVGGEPGITRAVTSRIQVCERPLMFLLDT 202

  Fly   385 PGLVFP--SSTPKSLQVLLGSFPISQLAVPYRSLKFLGEHLNLPQLL---------------RLH 432
            ||::.|  .|....|::.|.:..::...:.:    .:||......||               .|.
  Rat   203 PGVLAPRIQSVETGLKLALCAACLAGTVLDH----LVGEETMADYLLYTLNRHGLFGYVQHYALA 263

  Fly   433 LPEDYDEW--SAVAISDAWAYKRGFLT----AKAARPDRYRAANHILRMCLA---GQQMLVLQFY 488
            ...|:.||  ..|||......|...||    ....:||...||...||...:   ||.||.....
  Rat   264 SASDHIEWVLKNVAIKLGKTRKVKVLTGTGNVNVIQPDYAIAARDFLRTFRSGRLGQVMLDRDII 328

  Fly   489 P 489
            |
  Rat   329 P 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 41/134 (31%)
GTPase_YlqF 165..474 CDD:274669 63/241 (26%)
Mtg1XP_006230646.1 GTPase_YlqF 29..324 CDD:274669 68/254 (27%)
YlqF 29..206 CDD:206749 41/132 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.