DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and mtg1

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_021336162.1 Gene:mtg1 / 100150980 ZFINID:ZDB-GENE-031110-2 Length:319 Species:Danio rerio


Alignment Length:191 Identity:49/191 - (25%)
Similarity:66/191 - (34%) Gaps:80/191 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 GEVDLTTW--------EQKIREDMRSDQLDILDEISTA---VEG-ELKISSSIDTTPH------- 323
            ||.|:|.|        .:::|.::|:  :|.:.||..|   ..| ......|:|..||       
Zfish    20 GERDVTHWFPRHMAKGLKQMRANLRN--VDCIIEIHDARIPFSGRNSSFQESLDVRPHLLVLNKM 82

  Fly   324 ---------------------------------EHVK---------------YHSGVLTIGC--- 337
                                             |:||               :|.......|   
Zfish    83 DVADISKKQSILKQFEREGVKNVLFTDCLRQHDENVKKIVPLVSKLIESTSRFHREEERCYCLMV 147

  Fly   338 IGFPNVGKSSLINA-----LKGRKVVSVSRTPGHTKHFQT---IFLTPLVRLCDCPGLVFP 390
            ||.|||||||||||     ||..|...|...||.||...|   :...|::.|.|.||::.|
Zfish   148 IGVPNVGKSSLINALRRTYLKKGKASKVGAEPGITKAVLTKIQVCERPIIHLLDTPGVLPP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 48/189 (25%)
GTPase_YlqF 165..474 CDD:274669 49/191 (26%)
mtg1XP_021336162.1 RbgA 26..319 CDD:331156 45/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.