DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and Gnl3l

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001075427.1 Gene:Gnl3l / 100034253 RGDID:1600217 Length:577 Species:Rattus norvegicus


Alignment Length:494 Identity:119/494 - (24%)
Similarity:200/494 - (40%) Gaps:137/494 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KKELEQMKQEGFKPFEKLSPAQREVDDRYFAGCDFPVRPPWTLTESKEELDRTENRYFKEYVDEL 142
            ||.:|:|:       ||...|:                          |.:|..:|..:.|..::
  Rat    54 KKRVEEMR-------EKQQVAR--------------------------EQERQRHRTMESYCQDV 85

  Fly   143 QKKQRAGDSKELSLFELNL------ETWRQLW-----RVLEFSDILLIIVDVRYATLMFPP---- 192
            .|:|:..:.||..|.|||:      |..|:.:     :|:|:||::|.::|.|      .|    
  Rat    86 LKRQQEFEQKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDAR------DPLGCR 144

  Fly   193 --SLYDYIINTL-KKHAIVVFNKVDLVEPHAVVAWRQYFRDRYPQLPVVLFASFLPRSRKGSQRG 254
              .:.:.::... .|..::|.||:|||....|..|.:|.|:   :||.|.|           :..
  Rat   145 CFQMEETVLRAEGNKKLVLVLNKIDLVPKEIVEKWLEYLRN---ELPTVAF-----------KAS 195

  Fly   255 PQAHRRSMEGVYNIYKECQRYVQGEVDLTTWEQKIREDMRSDQLDILDEISTAVEGELKISSSID 319
            .|.|:     |.|:.: |               |:..|..|:.| :..:.....|..:::..:  
  Rat   196 TQHHQ-----VKNLTR-C---------------KVPVDQASESL-LKSKACFGAENLMRVLGN-- 236

  Fly   320 TTPHEHVKYHSGVLTIGCIGFPNVGKSSLINALKGRKVVSVSRTPGHTKHFQTIFLTPLVRLCDC 384
               :..:....|.:.:|.:|.||||||||||:||..:..||...||.||..|.::|...:||.|.
  Rat   237 ---YCRLGEIRGHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGVTKFMQEVYLDKFIRLLDA 298

  Fly   385 PGLVF-PSSTPKSLQVLLGSFPISQLAVPYRSLKFLGEHLNLPQLLRLHLPEDYDEWSAVAISDA 448
            ||:|. |:|...:  :|.....:.:||.|...::.:.:..||         |:...:..|:   .
  Rat   299 PGIVAGPNSEVGT--ILRNCIHVQKLADPVTPVETILQRCNL---------EEISNYYGVS---G 349

  Fly   449 WAYKRGFLTAKAARPDRYR---------AANHILRMCLAGQQMLVLQFY---PPGFEERREHWL- 500
            :.....||||.|.|..:.:         ||..:|...::|:    :.||   ||      .|.| 
  Rat   350 FQTTEHFLTAVAHRLGKKKKGGVYSQEQAAKAVLADWVSGK----ISFYTPPPP------THTLP 404

  Fly   501 QHPDVGEVKKYQQVELDEPESETNGDTSSVCSDTADSED 539
            .|.....||:..:|...|...:.|.||.. |....:|::
  Rat   405 THLSAEIVKEMTEVFDIEDTEQANEDTME-CLAVGESDE 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 63/239 (26%)
GTPase_YlqF 165..474 CDD:274669 81/330 (25%)
Gnl3lNP_001075427.1 GTPase_YlqF 119..391 CDD:274669 82/336 (24%)
Nucleostemin_like 129..301 CDD:206753 57/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.