DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amacr and Amacr

DIOPT Version :10

Sequence 1:NP_610054.1 Gene:Amacr / 35337 FlyBaseID:FBgn0032881 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_317033.3 Gene:Amacr / 1277563 VectorBaseID:AGAMI1_006573 Length:380 Species:Anopheles gambiae


Alignment Length:113 Identity:31/113 - (27%)
Similarity:41/113 - (36%) Gaps:27/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ERGKPSRMILTSEGTMKVLVHNGMDWESTYEGPANSCDIYGVCGPFGLCVVSIPPKCKCFKGFVP 309
            ||.|.......:...|..|||:.:  |......|:|.|:.|...|..   .|:.| .|..|..|.
Mosquito   119 EREKADERSQQNMDKMMALVHSLV--ERVDRSHASSYDVVGQKNPSS---SSLKP-AKRVKSAVV 177

  Fly   310 K-------------FAKEWKKGNWTSGCVRRTELHCQGNSSGKDANVF 344
            :             .|||.||       :|..|....|.|:.:| |||
Mosquito   178 RQSNLAKRTGAPVDAAKELKK-------IRDEENRNHGRSAERD-NVF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmacrNP_610054.1 CaiB 1..366 CDD:441409 31/113 (27%)
AmacrXP_317033.3 None

Return to query results.
Submit another query.