DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CarT and CG31103

DIOPT Version :9

Sequence 1:NP_610052.1 Gene:CarT / 35334 FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:471 Identity:101/471 - (21%)
Similarity:182/471 - (38%) Gaps:104/471 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YG-VNWTQLLESGEEDDLTTMEPNASWPLIKCPQGWEYNTSVVWSSIVIDFDLVCDQDIYPTIGL 182
            || ..|..||.||.. .:|::....:..:|......|:.|:.....::                :
  Fly    26 YGKTQWVLLLVSGLL-TITSVAAQQAMSIIVIASQCEFETTQAEKGVM----------------M 73

  Fly   183 AALNTGGPVGVYLFGLLNDRGGRR--LSY--FVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTI 243
            ||..||..:..|::|.::|..|||  |.|  |...|.......:||:    |.:....::||:::
  Fly    74 AASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSV----WLFNIINLLVGISV 134

  Fly   244 PAV----------YQIPFIISLELVGENYRSFVTVMTCTFY--TSGIMLLS--GVT---YLERDW 291
            .||          :.||   ....|..||.:....:|..:.  |:.::|.|  .:|   ::.|.|
  Fly   135 GAVSAALYAYLSEFNIP---RHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPW 196

  Fly   292 VRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEEALKILERMAKVN-GREFPEAVH-----LK 350
            ..|..::.||.:...|.:...||||::||.:.:..||::.:..::|.| |:...:.:.     ||
  Fly   197 RLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLK 261

  Fly   351 LEAQIRRDKLKKQKKKMANVG-LADLCRT-------PNMRLKTILITLSWFANETVYLGLSYYGP 407
            .|..:..:.|.:.:    ..| |:.:||.       |: ....||..|:.|.......|:..:.|
  Fly   262 SEDPVGENLLGESQ----GCGILSKICRATIPLFHKPH-GFNFILCNLALFGMFFSSNGMQLWFP 321

  Fly   408 --------ALGTNQYVSFFLSAVVELPSY---LCC--------------------------WYFM 435
                    |...:..|...||..||.|:.   |.|                          ...:
  Fly   322 EIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLIL 386

  Fly   436 DTWGRRWPLSLSMILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPTQVR 500
            :..||:..|..::.:..::.|:...:  ::....|||:.:...|...|..|:.....:|.||.:|
  Fly   387 NPLGRKNVLLAALAVATLSGVLLHFM--ESPTGVLVLFCLYILLPGLSISIMIGAIVDLVPTHLR 449

  Fly   501 GIGIGASSYIGGLGLI 516
            ...:.....:|.||:|
  Fly   450 SKAVSFCMSLGRLGII 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CarTNP_610052.1 2A0119 44..561 CDD:273328 101/471 (21%)
MFS 182..551 CDD:119392 90/407 (22%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 99/468 (21%)
MFS 34..>189 CDD:119392 39/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.