DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CarT and CG4324

DIOPT Version :9

Sequence 1:NP_610052.1 Gene:CarT / 35334 FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:375 Identity:83/375 - (22%)
Similarity:162/375 - (43%) Gaps:55/375 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LNDRGGRRLSYFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIPFIISLELVGENYR 263
            |::|.||:.:..:....|:..|:::|::..:......|.:||..|..|.|...:.:..|..::..
  Fly   115 LSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYAEFLPTKHKG 179

  Fly   264 SFVTVMTCTFYTSGI---MLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRL 325
            ..|.:|.| |:..|.   ::|:.|.|....|..|..:::.|...:.:....:.||.|:....|..
  Fly   180 KCVVLMDC-FWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHN 243

  Fly   326 EEALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCR---TPNMRLKTIL 387
            ::|:|:||::|..|.|      |:.:...:..|:          ...|:..|   :|::...|||
  Fly   244 DKAIKVLEQIAHNNKR------HMLMGRLMADDE----------PSCAESFRSLLSPSLYRTTIL 292

  Fly   388 ITLSWFANETVYLGLSYYGPALGT-------------NQYVSFFLS--------AVVELPSYLCC 431
            :...|.|:     ...|||..|.|             |:.|:|..|        .:.|.|..|..
  Fly   293 LWFLWLAS-----AFCYYGLVLVTTELLVARNKESHPNECVTFMTSDFMDLLWITLSEFPGILLT 352

  Fly   432 WYFMDTWGRRWPLSLSMILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYP 496
            ...:..:|::..:.| ..|..|.|.:.:|..:.....::.|: :::..:|..|..||.:..|:||
  Fly   353 IKVVKLFGKKKTIVL-QYLALVLCTLVLMSVESRFSTSVTLF-IARGTISGIFQAIYVYTPEIYP 415

  Fly   497 TQVRGIGIGASSYIGGLGLIGIPFITYLGKDNLKLPLV----IMGFLSML 542
            ..:|.:|:...|.:..||.:..||:..:..|:.::..:    |:|.|:.:
  Fly   416 AALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTYAIVGLLASI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CarTNP_610052.1 2A0119 44..561 CDD:273328 83/375 (22%)
MFS 182..551 CDD:119392 83/375 (22%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 83/375 (22%)
MFS 60..471 CDD:119392 83/375 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.