DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CarT and CG3690

DIOPT Version :9

Sequence 1:NP_610052.1 Gene:CarT / 35334 FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001284764.1 Gene:CG3690 / 31047 FlyBaseID:FBgn0040350 Length:558 Species:Drosophila melanogaster


Alignment Length:479 Identity:103/479 - (21%)
Similarity:172/479 - (35%) Gaps:124/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IKCPQGWEYNTSV---VWSSIVIDFDL-VCDQDIYPTIGLAALNTGGPV-GVYLFGLLNDRGGRR 206
            :....|..|.||.   :..|...|..| :.|:.|     |.|:...|.: ...|:|.|.|..|||
  Fly    53 VPAAMGTVYETSTMSYILPSAECDLKLSLLDKGI-----LNAITYAGMISSAVLWGYLADIKGRR 112

  Fly   207 ----LSYFVCLATLLAGSLMTS-LSKDFWTWAGSRVIVGLTIPAVYQIPFIISL----ELVGENY 262
                :.|......:|.|:|..| :....:.:.|...:.|         ||.:.:    ||.|..:
  Fly   113 NLLIVGYAADTICVLGGALSQSRIQLMVFKYLGGFCMSG---------PFAVLMTYLTELHGRKH 168

  Fly   263 RSFVTVMTCTFYTSGIMLLSGVTYL--------------ERDWVRLSYITSLPFYAYFLYMFVMP 313
            |..:.:|....::...:.|.|:..|              ...|.....:|:||....|:..|..|
  Fly   169 RQRIMMMVGIMFSIATLTLPGLAMLILPETWNIQIWTLSLTSWQFFVAVTALPSLLSFVLFFFFP 233

  Fly   314 ESPRWLLMRGRLEEALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKKKMANVGLADLCRT 378
            |||::|:.:||..|||...:.|..:|.|:..::..:||.|......:||..|        |....
  Fly   234 ESPKFLMSKGRNREALDAFKFMYHLNSRKPKDSFPIKLLANEVIVPVKKHAK--------DETIP 290

  Fly   379 PNMRLKTILITLSWFANE-----TVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDTW 438
            ..::|.|..:.:....|:     ::..|.:...| |.|..|:.            |..|.::   
  Fly   291 TELKLPTECVEVQDPENQDSKKSSLRSGFTQLRP-LFTKPYLG------------LSLWVYL--- 339

  Fly   439 GRRWPLSLSMILGGVACVITVMLPD--DAVDETLVLY--LVSKALLSASFLIIYPFAGELYPTQV 499
                 |:..::||  ...:.:.||.  .:::|    |  |:|....|.|...|..::.....:|:
  Fly   340 -----LNFCVLLG--QNTMRLWLPQLFASINE----YENLMSGESQSTSICNILEYSVNRTQSQL 393

  Fly   500 RGIG-----------IGASSYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGM-----TGL 548
            ..:.           |..|:|...|.:.|..|:.|:          :.|||..|.|:     :||
  Fly   394 EAVTRNDPTVECHVIITPSTYTNNLIVAGAGFVAYM----------LAGFLVNLVGVKLIMTSGL 448

  Fly   549 RLPETLHHRLPQTIEEGEEFGKNW 572
                        .|..|...|..|
  Fly   449 ------------LIAAGCSIGMYW 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CarTNP_610052.1 2A0119 44..561 CDD:273328 99/466 (21%)
MFS 182..551 CDD:119392 90/417 (22%)
CG3690NP_001284764.1 SP 42..549 CDD:273317 103/479 (22%)
MFS 49..>195 CDD:119392 36/155 (23%)
MFS 419..>550 CDD:119392 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.