DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9316 and CG32085

DIOPT Version :9

Sequence 1:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster


Alignment Length:435 Identity:98/435 - (22%)
Similarity:148/435 - (34%) Gaps:161/435 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SLETVPLPQ--LIRFFKVAGPF-IRVLQVDCASYQK---------ESLLVEFVKEYCPNLEEI-- 142
            |:|.:.|..  |.|||:...|: .|:|...|..::.         ..||...   .|..|.::  
  Fly   279 SIEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTL---QCRELRQMPG 340

  Fly   143 -----------------------SYSNATDEFHYRSIMSKMTHLKRVTIECLDAED----VLNFD 180
                                   |..:|.|..|...:.||  |:..:::.|....|    .|...
  Fly   341 CDRGKLYNSLIRRGFHALGLVGASDEDALDVVHSFPLASK--HVHSLSLRCSSISDRGLETLLDH 403

  Fly   181 MQPNQELEFFELVNGC----YTGQNLCGFPNLKTLVLRDC-------------LLWNSMEFGIPL 228
            :|...|||    :.||    ..|...|..|.:.:|.|.||             ||.:..||.:..
  Fly   404 LQSLFELE----LAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQA 464

  Fly   229 -------------KSLHTLDL--DDCCFEVMNVSLYQKIAESCTNLVELIFSGC----DTNFEVI 274
                         |..|:|.:  ...|:|:.|..:. .|..|..:|..|..|||    |...|:|
  Fly   465 YHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIV-NIVHSLPHLTVLSLSGCSKLTDDGVELI 528

  Fly   275 A-NLPKLERCTLKTWMTSNELNIGFLTVLAEKRGNKLTHLHLSGQFNITNEHARCLGQLSSLTDL 338
            | ||.||....| :|..                  ::|...|        |:..|          
  Fly   529 AENLQKLRALDL-SWCP------------------RITDASL--------EYIAC---------- 556

  Fly   339 RFSNNDILDDDHFKFFNDLSQLERFGLTACGRVMDVG---MMRMLRKCPQLKVIDLTDCEQITEE 400
                             ||:|||...|..|..:.|:|   :..||    .|..:.|..|.|: .:
  Fly   557 -----------------DLNQLEELTLDRCVHITDIGVGYISTML----SLTALFLRWCSQV-RD 599

  Fly   401 FVIQAIGFCSKGSGRDV-VLNVKGTMIRRPILTHPDYVNSLNRLK 444
            |.:|.:  ||.   |:: ||::.|.    |:||... ::||.:|:
  Fly   600 FGLQHL--CSM---RNLQVLSLAGC----PLLTSSG-LSSLIQLR 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 6/25 (24%)
leucine-rich repeat 231..258 CDD:275381 7/28 (25%)
leucine-rich repeat 259..279 CDD:275381 11/24 (46%)
leucine-rich repeat 280..309 CDD:275381 3/28 (11%)
AMN1 310..>411 CDD:187754 22/103 (21%)
leucine-rich repeat 310..334 CDD:275381 4/23 (17%)
leucine-rich repeat 335..359 CDD:275381 2/23 (9%)
leucine-rich repeat 360..385 CDD:275381 8/27 (30%)
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 3/23 (13%)
AMN1 383..600 CDD:187754 62/280 (22%)
leucine-rich repeat 431..456 CDD:275381 6/24 (25%)
leucine-rich repeat 457..482 CDD:275381 3/24 (13%)
leucine-rich repeat 483..508 CDD:275381 6/25 (24%)
leucine-rich repeat 509..534 CDD:275381 11/24 (46%)
leucine-rich repeat 535..560 CDD:275381 9/78 (12%)
leucine-rich repeat 561..585 CDD:275381 8/27 (30%)
leucine-rich repeat 586..610 CDD:275381 8/29 (28%)
leucine-rich repeat 636..661 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.