Sequence 1: | NP_610051.2 | Gene: | CG9316 / 35333 | FlyBaseID: | FBgn0032878 | Length: | 448 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608880.2 | Gene: | jet / 33705 | FlyBaseID: | FBgn0031652 | Length: | 319 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 80/199 - (40%) | Gaps: | 50/199 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 216 CLLWNSMEFGIPL-----KSLHTLDLDDCCFEVMNVSLYQKIAESCTNLVELIFSGCDTNFEVIA 275
Fly 276 NLPKLERCTLKTWMTSNELNIGFLTVLAEKRGNKLTHLHLS-----GQFNITNEHARCL----GQ 331
Fly 332 LSSLTDLRFSNN-DILDDDHFKFFNDLSQLERFGLTACGRVMDVGMMRMLRKCPQLKVIDLTDCE 395
Fly 396 QITE 399 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9316 | NP_610051.2 | leucine-rich repeat | 208..221 | CDD:275381 | 2/4 (50%) |
leucine-rich repeat | 231..258 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 259..279 | CDD:275381 | 2/19 (11%) | ||
leucine-rich repeat | 280..309 | CDD:275381 | 6/28 (21%) | ||
AMN1 | 310..>411 | CDD:187754 | 23/100 (23%) | ||
leucine-rich repeat | 310..334 | CDD:275381 | 7/32 (22%) | ||
leucine-rich repeat | 335..359 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 360..385 | CDD:275381 | 6/24 (25%) | ||
jet | NP_608880.2 | leucine-rich repeat | 85..110 | CDD:275381 | |
AMN1 | 96..>261 | CDD:187754 | 42/177 (24%) | ||
leucine-rich repeat | 111..137 | CDD:275381 | 5/18 (28%) | ||
leucine-rich repeat | 138..163 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 164..189 | CDD:275381 | 9/49 (18%) | ||
leucine-rich repeat | 190..215 | CDD:275381 | 7/32 (22%) | ||
leucine-rich repeat | 216..241 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 242..267 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 268..290 | CDD:275381 | 4/14 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45468454 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |