DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9316 and jet

DIOPT Version :9

Sequence 1:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster


Alignment Length:199 Identity:47/199 - (23%)
Similarity:80/199 - (40%) Gaps:50/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 CLLWNSMEFGIPL-----KSLHTLDLDDCCFEVMNVSLYQKIAESCTNLVELIFSGCDTNFEVIA 275
            |..|.:.|..:||     |.|..::|:: |..:..:|| |.|...|..|..|             
  Fly   118 CCRWLTDELLLPLLANNKKRLWAVNLNE-CVNITALSL-QPIIVECKELRVL------------- 167

  Fly   276 NLPKLERCTLKTWMTSNELNIGFLTVLAEKRGNKLTHLHLS-----GQFNITNEHARCL----GQ 331
               ||.:|   .|:|:..::.  ||:    ..:||....:|     |:        |||    .:
  Fly   168 ---KLSKC---QWLTTGAVDA--LTL----HQSKLVEFDISYCGAIGE--------RCLIIFFRK 212

  Fly   332 LSSLTDLRFSNN-DILDDDHFKFFNDLSQLERFGLTACGRVMDVGMMRMLRKCPQLKVIDLTDCE 395
            |:.||.|..:|. .:.|....:..|...:||...:..|..:.|.|:..:...|.:|:.:.:..|.
  Fly   213 LNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLLIRRCP 277

  Fly   396 QITE 399
            ::||
  Fly   278 RVTE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 2/4 (50%)
leucine-rich repeat 231..258 CDD:275381 8/26 (31%)
leucine-rich repeat 259..279 CDD:275381 2/19 (11%)
leucine-rich repeat 280..309 CDD:275381 6/28 (21%)
AMN1 310..>411 CDD:187754 23/100 (23%)
leucine-rich repeat 310..334 CDD:275381 7/32 (22%)
leucine-rich repeat 335..359 CDD:275381 6/24 (25%)
leucine-rich repeat 360..385 CDD:275381 6/24 (25%)
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381
AMN1 96..>261 CDD:187754 42/177 (24%)
leucine-rich repeat 111..137 CDD:275381 5/18 (28%)
leucine-rich repeat 138..163 CDD:275381 8/26 (31%)
leucine-rich repeat 164..189 CDD:275381 9/49 (18%)
leucine-rich repeat 190..215 CDD:275381 7/32 (22%)
leucine-rich repeat 216..241 CDD:275381 6/24 (25%)
leucine-rich repeat 242..267 CDD:275381 6/24 (25%)
leucine-rich repeat 268..290 CDD:275381 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.