DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and RNF26

DIOPT Version :9

Sequence 1:NP_001260636.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_114404.1 Gene:RNF26 / 79102 HGNCID:14646 Length:433 Species:Homo sapiens


Alignment Length:436 Identity:89/436 - (20%)
Similarity:146/436 - (33%) Gaps:178/436 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDALIRAAELVDLVLLRPLASVI----------DAVITGVYYFLWGSYLVGFCLVEGSRKGWNL 55
            :||.|....:|..|::...|||:.          ..|:|.:.:...|..|....|:|        
Human    14 VLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRGVLLSLLALIE-------- 70

  Fly    56 LRCAVRNINEGIRDL---------GLITLDVADYF--YGGTKG------GLKNVLDFGHCISR-- 101
              ..||....|::.|         ||.:|.:..:.  :|..:.      |:.||:..||.:.|  
Human    71 --AVVRFTCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVLNVVSSGHALLRQA 133

  Fly   102 ------------FICNLLID---LGDGILWLLMLLPRAILFLWDCL------LDFVVHSIVAH-- 143
                        ::.|.|::   :|...|:.|      :|.|||.:      :..||.:.:||  
Human   134 CDICAIAMSLVAYVINSLVNICLIGTQNLFSL------VLALWDAVTGPLWRMTDVVAAFLAHIS 192

  Fly   144 ----------------GLSLLNSAFR--ASIGLALLLVLYMFRRYVYLMLIYLLQRGRIEISTK- 189
                            .|.||.||.|  ||..|..|..|.:....:.:.:..|.....:.::|: 
Human   193 SSAVAMAILLWTPCQLALELLASAARLLASFVLVNLTGLVLLACVLAVTVTVLHPDFTLRLATQA 257

  Fly   190 -TQSVYLWTHHKLQHFI-------------HNVWYVS------ENAGSAS--------------- 219
             :|.....::|:|:..:             ..||..|      .|.|.|.               
Human   258 LSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASWPNRGGAPGAPQGDPMRVFSVRT 322

  Fly   220 ------PE------------------------------------------------RCVVCMAQS 230
                  ||                                                :||:|..||
Human   323 RRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEEPPGGQDPWKLLKEQEERKKCVICQDQS 387

  Fly   231 RNVVVMPCRHLCLCKECSLQLVL--LLEDRCPVCRHNITSFLSVYV 274
            :.|:::||||||||:.|:..|:.  :....||:||..|...|:||:
Human   388 KTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 21/47 (45%)
RNF26NP_114404.1 mRING-HC-C3HC5_RNF26 378..425 CDD:319702 20/46 (43%)
modified RING-HC finger (C3HC5-type) 380..421 CDD:319702 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7529
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006367
OrthoInspector 1 1.000 - - oto91364
orthoMCL 1 0.900 - - OOG6_113023
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9347
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.