DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and Rnf157

DIOPT Version :9

Sequence 1:NP_001260636.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_038943400.1 Gene:Rnf157 / 688272 RGDID:1591154 Length:699 Species:Rattus norvegicus


Alignment Length:146 Identity:42/146 - (28%)
Similarity:65/146 - (44%) Gaps:29/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VVHSIV-------AHGLSLLNSAFRASIGLALLLVLYMFRRYVYLMLIYLLQR--GRIEISTKTQ 191
            |||::|       .|...||.:..:.|.|  ...|..:.::.|...:.||||.  | ||....||
  Rat   200 VVHAVVDEGDEYFGHCHVLLGTFEKHSDG--TFCVKPLKQKQVVDGVSYLLQEIYG-IENKYNTQ 261

  Fly   192 SVYLWTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLE 256
            ..                .|:|:..|.:...||||::..|:.:::||||||||..|: ..:....
  Rat   262 DS----------------KVAEDDVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCA-DTLRYQA 309

  Fly   257 DRCPVCRHNITSFLSV 272
            :.||:||....:.|.:
  Rat   310 NNCPICRLPFRALLQI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 18/45 (40%)
Rnf157XP_038943400.1 KilA-N <236..330 CDD:392051 32/108 (30%)
mRING-HC-C3HC5_MGRN1_like---blasttree 276..316 CDD:319703 16/40 (40%)
Atrophin-1 <317..>564 CDD:397323 1/9 (11%)
fibronec_FbpA <477..>571 CDD:411474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22996
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.