DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and Mgrn1

DIOPT Version :9

Sequence 1:NP_001260636.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006245854.1 Gene:Mgrn1 / 302938 RGDID:1311862 Length:578 Species:Rattus norvegicus


Alignment Length:61 Identity:21/61 - (34%)
Similarity:36/61 - (59%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
            |::..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
  Rat   268 SDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCA-DTLRYQANNCPICRLPFRALLQI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 18/45 (40%)
Mgrn1XP_006245854.1 PHA02929 <233..332 CDD:222944 21/61 (34%)
rad18 274..>516 CDD:273165 19/55 (35%)
zf-C3HC4_3 278..320 CDD:290631 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22996
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.