DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and Rnf26

DIOPT Version :9

Sequence 1:NP_001260636.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001107220.1 Gene:Rnf26 / 300659 RGDID:1305953 Length:424 Species:Rattus norvegicus


Alignment Length:417 Identity:90/417 - (21%)
Similarity:145/417 - (34%) Gaps:149/417 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDALIRAAELVDLV---LLRPLASVI-------DAVITGVYYFLWGSYLVGFCLVE-------G 48
            |||.|....:|..|:   ||..||.::       ..|:|.:.:...|..|....|||       |
  Rat    14 MLDLLTLVLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRGFLLYLVALVEAVVRFTFG 78

  Fly    49 SRKGWNLLRCAVRNINEGIRDLGLITLDVADYFYGGTKG------GLKNVLDFGHCISRFICNLL 107
            ..:....|.|:..:..|.::.||.:.      .:|..|.      |:.|::..||.:.|..|::.
  Rat    79 GLQALCTLLCSCYSGLESLKLLGHLA------SHGALKSRELLNRGILNMISNGHGLLRQACDIC 137

  Fly   108 IDLGDGILWLLMLLPR-----------AILFLWDCL------LDFVVHSIVAH------------ 143
            ......:.:::..|..           .:|.|||.:      :..||...:||            
  Rat   138 AIAMSLVAYVVNSLVNICLIGTQNFFSLVLALWDAVTGPLWRMTDVVAGFLAHISSSAVAMAILL 202

  Fly   144 ------GLSLLNSAFR--ASIGLALLLVLYMFRRYVYLMLIYLLQRGRIEISTK--TQSVYLWTH 198
                  .|.||.||.|  ||..|..|..|.:....:.::||.|.....:.::|:  .|.....::
  Rat   203 WTPCQLVLELLASAVRVLASCVLFHLTGLVLLACVLVVILIALHPEQTLRLATRALNQLHARPSY 267

  Fly   199 HKLQHFI-------------HNVWYVS------ENAGSAS---------------------PE-- 221
            |:|:..:             ..||..|      .|.|.|.                     ||  
  Rat   268 HRLREDVVRLSRLPLGLEAWRRVWSRSLQLASWPNRGGAPGAPQGGPRRVFSARIQPQDPLPEAD 332

  Fly   222 -------------------------------------RCVVCMAQSRNVVVMPCRHLCLCKECSL 249
                                                 :||:|..||:.|:::||||||||:.|:.
  Rat   333 EEVIRTAAARGRERLNEEEPTAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTE 397

  Fly   250 QLVL--LLEDRCPVCRHNITSFLSVYV 274
            .|:.  :....||:||.:|...|:||:
  Rat   398 ILMRHPVYHRNCPLCRRSILQTLNVYL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 21/47 (45%)
Rnf26NP_001107220.1 zf-C3HC4_3 367..419 CDD:290631 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006367
OrthoInspector 1 1.000 - - oto98447
orthoMCL 1 0.900 - - OOG6_113023
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.