Sequence 1: | NP_001260636.1 | Gene: | CG2617 / 35331 | FlyBaseID: | FBgn0032877 | Length: | 274 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506354.2 | Gene: | C56A3.4 / 179836 | WormBaseID: | WBGene00008343 | Length: | 221 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 78/203 - (38%) | Gaps: | 72/203 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 FICNLLIDLGDGILWLLMLLPRAILFLWDCLLDFVVHSIVAHGLSLLNSAFRASIGLALLLVLYM 166
Fly 167 FRRYVYLMLIYLLQRGRIEISTKTQSVYLWTHHKLQHFIHNVWYVSEN----------------- 214
Fly 215 --AGSASPE--------RCVVCMAQSRNVVVMPCRHLCLCKECS----LQLVLLLEDRCPVCRHN 265
Fly 266 ITSFLSVY 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2617 | NP_001260636.1 | zf-C3HC4_3 | 223..269 | CDD:290631 | 16/49 (33%) |
C56A3.4 | NP_506354.2 | zf-C3HC4_3 | 167..214 | CDD:372816 | 16/50 (32%) |
modified RING-HC finger (C3HC5-type) | 170..209 | CDD:319361 | 15/42 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0006367 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |