DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and C56A3.4

DIOPT Version :9

Sequence 1:NP_001260636.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_506354.2 Gene:C56A3.4 / 179836 WormBaseID:WBGene00008343 Length:221 Species:Caenorhabditis elegans


Alignment Length:203 Identity:44/203 - (21%)
Similarity:78/203 - (38%) Gaps:72/203 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FICNLLIDLGDGILWLLMLLPRAILFLWDCLLDFVVHSIVAHGLSLLNSAFRASIGLALLLVLYM 166
            ||..:||.|  .:...|...||      :..:.::::::|.:|:|:                   
 Worm    59 FIATVLITL--YVYRRLSSTPR------ESFISYILYTVVPYGVSI------------------- 96

  Fly   167 FRRYVYLMLIYLLQRGRIEISTKTQSVYLWTHHKLQHFIHNVWYVSEN----------------- 214
                ||.::.::..  ::.|.|:...|.|.....:..||..|    :|                 
 Worm    97 ----VYTVVGFIFP--QVRIVTRIIDVLLHPIKFILGFIEKV----DNRAAPIRRTVEAIHGPKP 151

  Fly   215 --AGSASPE--------RCVVCMAQSRNVVVMPCRHLCLCKECS----LQLVLLLEDRCPVCRHN 265
              ||..|.|        :|.:|....:.|::.||.|||.|:.|:    .|:.||    ||:|..:
 Worm   152 PKAGVKSVEDSINEARLQCFLCKLTEKRVLLRPCNHLCFCEPCNDTFQKQIPLL----CPICHMH 212

  Fly   266 ITSFLSVY 273
            :.||..|:
 Worm   213 VQSFEIVH 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 16/49 (33%)
C56A3.4NP_506354.2 zf-C3HC4_3 167..214 CDD:372816 16/50 (32%)
modified RING-HC finger (C3HC5-type) 170..209 CDD:319361 15/42 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.