powered by:
Protein Alignment CG2617 and Mgrn1
DIOPT Version :9
Sequence 1: | NP_001260636.1 |
Gene: | CG2617 / 35331 |
FlyBaseID: | FBgn0032877 |
Length: | 274 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001365941.1 |
Gene: | Mgrn1 / 17237 |
MGIID: | 2447670 |
Length: | 578 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 21/61 - (34%) |
Similarity: | 36/61 - (59%) |
Gaps: | 1/61 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 SENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
|::..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
Mouse 267 SDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCA-DTLRYQANNCPICRLPFRALLQI 326
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4265 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22996 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.000 |
|
Return to query results.
Submit another query.