DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31678 and AT4G23950

DIOPT Version :9

Sequence 1:NP_724277.2 Gene:CG31678 / 35327 FlyBaseID:FBgn0051678 Length:1417 Species:Drosophila melanogaster
Sequence 2:NP_001190819.1 Gene:AT4G23950 / 828495 AraportID:AT4G23950 Length:562 Species:Arabidopsis thaliana


Alignment Length:308 Identity:88/308 - (28%)
Similarity:138/308 - (44%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 AQKQMEAEASREQAMELEQQVVNKSAQRKNNTGSSSGKPPTLKLRSKNYASPDCGAKIIAHNSES 413
            ::|.:||...|...:|.:...||.|:|..||......:|..   ...||||...|||::.||.|:
plant   136 SKKTLEARDPRYVNLEDKSLKVNGSSQLVNNGTRYRLEPDG---NGYNYASAMKGAKVVDHNKEA 197

  Fly   414 KHTEAVLTQSTDEYMLSTCE-SRIWFVVELCEAIQAQKVDVANYELFSSSPKNFTVAVSKRFPTR 477
            |....||.:..|:|:.:.|. |..:.|:||.|......|.:||:|.:||:||.|:::.|..||:.
plant   198 KGASNVLGKDHDKYLRNPCSVSDKYVVIELAEETLVDTVRIANFEHYSSNPKEFSLSGSLSFPSD 262

  Fly   478 DWSNVGRFAAEDKRTIQTFELHPHLFGKFVRVDITSHYANEHFCPLSLFRVFGTSEYEAF----- 537
            .|:..|.|||.:.:.||:|.|....:.:::::::.|||.:|.:|.||:..|||....|..     
plant   263 MWTPAGSFAAANVKQIQSFRLPEPKWLRYLKLNLVSHYGSEFYCTLSVVEVFGIDALEQMLEDLF 327

  Fly   538 ---ET--------EIRPSDDLDD------FYDDYG----AQEQKAAVGSGGNI------------ 569
               ||        |::.:|:..|      ..|..|    ||::|..|....||            
plant   328 VPSETPPSKPAMVELKTADEKQDGEIKSNRTDQIGKETEAQKKKDDVVKTINIIGDKKYEVKEKH 392

  Fly   570 ----------------FQSASDAVMQMVKKAAEVLVKPTKALKWSEES 601
                            .....|:|.:|..|..||.::..|.|...|:|
plant   393 NVLKVMMQKVKLIEMNLSLLEDSVKKMNDKQPEVSLEMKKTLVLVEKS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31678NP_724277.2 Sad1_UNC 409..532 CDD:285038 45/123 (37%)
AT4G23950NP_001190819.1 Sad1_UNC 193..315 CDD:285038 43/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2741
eggNOG 1 0.900 - - E1_KOG1396
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003583
OrthoInspector 1 1.000 - - otm2883
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12953
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.