DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and AT4G34360

DIOPT Version :9

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_195162.2 Gene:AT4G34360 / 829586 AraportID:AT4G34360 Length:248 Species:Arabidopsis thaliana


Alignment Length:168 Identity:60/168 - (35%)
Similarity:88/168 - (52%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKTREEFAQTDYWNEFFKKRGEKAFEWYGEYLELCDQIHKYIKPADRILMLGCGNSKLSMDMYDT 69
            |.:...:....||:|.|.  .|:.:||:.:|......|...|||:..:|.||||||:|..::|..
plant     9 PPSALTYLDPHYWDERFS--SEEHYEWFKDYSHFQHLIISNIKPSSSVLELGCGNSQLCEELYKD 71

  Fly    70 GFRDITNIDISPIAVKKM-LELNAKSRPEMKFLQMDATAMTFPDESFSVSLDKGTLDALFAD--- 130
            |..|||.||:|.:||:|| ..|..|...|:|.:|.|...:.|..|||.|.::|||:|.||.|   
plant    72 GIVDITCIDLSSVAVEKMQSRLLPKGYKEIKVVQADMLDLPFDSESFDVVIEKGTMDVLFVDAGD 136

  Fly   131 ---DEPETRAVVENYFKEILRTMRNGGRYVGISLLQEH 165
               ..|||.:.|......:.|.::..|.::.|:..|.|
plant   137 PWNPRPETVSKVMATLDGVHRVLKPDGIFISITFGQPH 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624 43/108 (40%)
AdoMet_MTases <483..>612 CDD:302624
AT4G34360NP_195162.2 Methyltransf_25 54..163 CDD:379312 43/108 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100611
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.