DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and AT4G13330

DIOPT Version :10

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_193069.1 Gene:AT4G13330 / 826963 AraportID:AT4G13330 Length:428 Species:Arabidopsis thaliana


Alignment Length:265 Identity:54/265 - (20%)
Similarity:92/265 - (34%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 MSVGVQLATTVQHPKR-----DVEKDVLVVGLGGGGLCSFLHAALPQARITAVEIDPIML----- 505
            :|||:......:...|     |.:..||.:|.|||.|..|:...:..|.:..||:||:::     
plant   162 VSVGLTSLAASKFDMRSVAIGDKQMRVLCIGHGGGSLPLFIAKHILGAVVDIVELDPLVISESVR 226

  Fly   506 ---------------------EVAEQYFELKQDKRFHVVIDDGLDFVERCRNEDIHFDAVLFDV- 548
                                 |:.:|.......:|..:......||:  .||:...:|.:..|. 
plant   227 AMGFPAFSVMTATGKRVLPTPEIIDQVMWGGIHERLSLYESKAEDFI--LRNQSNTYDLIFMDAY 289

  Fly   549 DSKDL---SLGMSCPPQSFLATKILQHIKEIIGPKGLFMLNLVCRDESLRTEALNN-------LH 603
            |..|:   ||..|........:|.|.|      ..|..::||....:....:..|.       :.
plant   290 DGADIFPHSLWDSSSVFMKALSKTLHH------EHGTLVVNLHSDADISDIDRSNEGVTTGKYVR 348

  Fly   604 KVFPAVCSYKLEEDINEIIYCANDEKYKTVEQWKKNMG-TAGRGLNSAVKETKLASED----ALE 663
            ||..|.....||.:.|.:::...       ..|..|:. ...||:.|..::.:....:    :||
plant   349 KVGKAYKKGLLENERNGLVFACE-------VPWLCNVSLVVSRGMGSEGRDREKTKSNLMKTSLE 406

  Fly   664 VAEFL 668
            |...|
plant   407 VDRVL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 Methyltransf_25 52..154 CDD:463945
SpeE <478..612 CDD:440190 34/170 (20%)
AT4G13330NP_193069.1 SpeE 187..>327 CDD:440190 33/147 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.