DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and CSKMT

DIOPT Version :10

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_005274289.1 Gene:CSKMT / 751071 HGNCID:33113 Length:363 Species:Homo sapiens


Alignment Length:155 Identity:39/155 - (25%)
Similarity:60/155 - (38%) Gaps:47/155 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FEWYGEYLELCDQIHKYIKPAD-----RILMLGCGNSKLSMDMYDTGFR--DITNIDISPIAVKK 86
            |:|:..|.|:...:...::.|.     |:|.:|||.|.|...:|.....  |:..:|.||:||..
Human   174 FDWFFGYDEVQGLLLPLLQEAQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAH 238

  Fly    87 M---LELNAKSRP--------EMKFLQMDATAM--TFPDESFSVSLDKGTLDAL----------- 127
            |   ||......|        .:.|:..||..:  .....||.:.|||||.||:           
Human   239 MNSLLEGGPGQTPLCPGHPASSLHFMHADAQNLGAVASSGSFQLLLDKGTWDAVARGGLPRAYQL 303

  Fly   128 ----------------FADDEPETR 136
                            |:|::|:.|
Human   304 LSECLRVLNPQGTLIQFSDEDPDVR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 Methyltransf_25 52..154 CDD:463945 33/127 (26%)
SpeE <478..612 CDD:440190
CSKMTXP_005274289.1 Methyltransf_31 198..>330 CDD:463998 34/131 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.