DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and cskmt

DIOPT Version :9

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_005172345.1 Gene:cskmt / 553815 ZFINID:ZDB-GENE-050522-31 Length:254 Species:Danio rerio


Alignment Length:171 Identity:55/171 - (32%)
Similarity:82/171 - (47%) Gaps:33/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WNEFFKKRGEKA----FEWYGEYLELCDQIHKYIKPAD-------RILMLGCGNSKLSMDMYDT- 69
            |:.|:.:.|.|.    |||:..:..:.|.:...::...       .||.:|||.|.|...:|.| 
Zfish    41 WDRFYTENGSKGQFKNFEWFFGFPSVKDLVLPALQAMSCSHSGPLHILDMGCGTSALGPCIYSTS 105

  Fly    70 --GFRDITNIDISPIAVKKMLELNAKS---RP-----EMKFLQMDATAMT--FPDESFSVSLDKG 122
              ..| :|..||||:|| |::|.:.||   :|     .:.||::|.|.||  |...|..:.||||
Zfish   106 PCAVR-VTCADISPVAV-KLIEEHTKSTSTKPCNPSSALVFLELDCTQMTGHFKPRSLDLILDKG 168

  Fly   123 TLDALFADDEPETRAVVENYFKEILRTMRNGGRYVGISLLQ 163
            |.|||....|.:.:|  ....::.|:.:|..|     ||||
Zfish   169 TTDALVRSKEGQVKA--GQILRQSLQVLRPSG-----SLLQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624 41/114 (36%)
AdoMet_MTases <483..>612 CDD:302624
cskmtXP_005172345.1 AdoMet_MTases 81..202 CDD:302624 45/129 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.