DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and F52F12.9

DIOPT Version :9

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001021486.2 Gene:F52F12.9 / 3565818 WormBaseID:WBGene00009942 Length:351 Species:Caenorhabditis elegans


Alignment Length:363 Identity:79/363 - (21%)
Similarity:137/363 - (37%) Gaps:91/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 KKLQDSANFQRLAVVTLHRDQVYSTLDEVKQELADSIKNLSPAGLTDQIPYLSLGSDVGKR---- 380
            |:|.|...:.  ||:..|.:...:.:  :..|..|...|.:...:.|:|.|...|:....|    
 Worm    37 KELTDEEFYD--AVLMKHFENKNNKV--IAAECPDPKDNSTCLYIIDRIGYFKDGTWFVARFLTP 97

  Fly   381 -ETLICGFSKISGDFRIEEVEANGKTLRRLIFLSNQFVVQSEALVKTVKIKGKKDRKKIDFGYL- 443
             ..|:.||..||             .|.:.:|.:|:....:|              ..:|.||: 
 Worm    98 APHLMKGFLSIS-------------RLAKPVFKTNRTANTAE--------------WPVDVGYMD 135

  Fly   444 -----ACQHHLYMSVGVQLATTVQHP-KRDVEKDVLVVGLGGGGLCSFLHAALPQARITAVEIDP 502
                 |.:.....|.|       ..| ..|:.:||..:|:..|||.||:.......::|.|:|||
 Worm   136 PLTPNAVEFTTLFSTG-------HFPLNHDITRDVTFLGVATGGLMSFMAEYFKNMKLTGVDIDP 193

  Fly   503 IMLEVAEQYFELKQDKRFHVVIDDGLDFVERCRNEDIHFDAVLFD-------VDSKDLSLGMSCP 560
            ....:|:::|..:..|...:.|.||.:|:::........||||.|       ||.      :.||
 Worm   194 QSEYLAKKWFGYQNRKNDRIFIADGAEFIKQMAENGETSDAVLVDACHNTEPVDD------IYCP 252

  Fly   561 PQSFLATKILQHIKEIIGPKGLFMLNLVCRD------ESLRTEALNNLHKVFPAVCSYKLEEDI- 618
            .......:.|.::.::||.||:...|:..:.      |.:|.:...:.|.     |.....:.: 
 Worm   253 VAPIRTPEFLDNLSKVIGTKGMTTFNVYIQKATIDNYERMRDDFSKHFHD-----CKLINSKHLL 312

  Fly   619 -NEIIYCANDEKY-------KT--------VEQWKKNM 640
             |..:.|:|...|       ||        :||:.:|:
 Worm   313 ANMFLVCSNKGIYDNGVDVNKTKKFLRNMKIEQFLRNV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624
AdoMet_MTases <483..>612 CDD:302624 33/141 (23%)
F52F12.9NP_001021486.2 AdoMet_MTases <153..>296 CDD:302624 39/148 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.