DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and Eef1akmt4

DIOPT Version :9

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_006248650.1 Gene:Eef1akmt4 / 102551435 RGDID:7732114 Length:255 Species:Rattus norvegicus


Alignment Length:170 Identity:58/170 - (34%)
Similarity:95/170 - (55%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPKTREEFAQTDYWNEFFKKRGEKA-FEWYGEYLELCDQIHKYIKPADRILMLGCGNSKLSMDMY 67
            ||:...::.|..||::.:|...:.. :||:|::......:...:.|.||||:||||||.||.:::
  Rat    13 LPERNLQYRQVQYWDQRYKDAADSGPYEWFGDFASFRALLEPELCPEDRILVLGCGNSALSYELF 77

  Fly    68 DTGFRDITNIDISPIAVKKMLELNAKSRPEMKFLQMDATAMTFPDESFSVSLDKGTLDALFADDE 132
            ..||.::|::|.||:.|..| ::.....|.:::..||..|:.||..||.|.|:|||||||.| .|
  Rat    78 LGGFPNVTSVDYSPVVVAAM-QVRYAHVPSLRWETMDIRALDFPSGSFDVVLEKGTLDALLA-GE 140

  Fly   133 PETRAV-------VENYFKEILRTMRNGGRYVGISLLQEH 165
            |:...|       |:....|:.|.:..|||::.::....|
  Rat   141 PDPWNVSSEGVHTVDQVLSEVSRVLVPGGRFISMTPAGPH 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624 43/108 (40%)
AdoMet_MTases <483..>612 CDD:302624
Eef1akmt4XP_006248650.1 Methyltransf_11 63..172 CDD:285453 44/110 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8815
eggNOG 1 0.900 - - E1_KOG2352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373793at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto96973
orthoMCL 1 0.900 - - OOG6_100611
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.