DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and eef1akmt4

DIOPT Version :9

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_002935188.4 Gene:eef1akmt4 / 100488253 -ID:- Length:238 Species:Xenopus tropicalis


Alignment Length:165 Identity:54/165 - (32%)
Similarity:91/165 - (55%) Gaps:13/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FAQTDYWNEFFKKRGEKA----FEWYGEYLELCDQIHKYIKPADRILMLGCGNSKLSMDMYDTGF 71
            :.::.||:.  :.|.|:|    ::|:|.|.|..:...:.::|..|.|:||||.|.||||:|:.|.
 Frog     2 YKESSYWDA--RYREERALPNGYDWFGRYREFRELFIRELQPGARGLVLGCGTSSLSMDLYEEGI 64

  Fly    72 RDITNIDISPIAVKKMLELNAKSRPEMKFLQMDATAMTFPDESFSVSLDKGTLDALFADD-EP-- 133
            ..:.:||.|||.:|:|.|.:|... .|.:|.|||..:.|.|.||...::||||||:...: :|  
 Frog    65 CPLVSIDYSPICIKEMAEKHAGCH-GMSWLVMDARKLQFADGSFDFVIEKGTLDAMMVGERDPWR 128

  Fly   134 ---ETRAVVENYFKEILRTMRNGGRYVGISLLQEH 165
               |..|:::....|:.|.:...|.::.::....|
 Frog   129 VTSEAIALIDEVLSEVSRVLSPNGCFISVTFSPPH 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624 41/107 (38%)
AdoMet_MTases <483..>612 CDD:302624
eef1akmt4XP_002935188.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373793at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.