DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and AT4G29850

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_194714.1 Gene:AT4G29850 / 829107 AraportID:AT4G29850 Length:103 Species:Arabidopsis thaliana


Alignment Length:104 Identity:29/104 - (27%)
Similarity:45/104 - (43%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YIKVVESQCETDGFVNEQWTEPAMPGPVPWKTIIIILLLFIG--GIVCIAFATLNWVTDTSRERS 89
            |:....|..:.|..:...:|....| ||....:.:.||:| |  |||...|...|.|   ..:|.
plant     3 YVDHAFSITDEDIMIETSYTVNNRP-PVKEIALAVALLVF-GTLGIVSGFFMAYNRV---GGDRG 62

  Fly    90 DRVWALGIIGALTFIPGSYYVYVLFCIMLNRNGFTMDEI 128
            ..::.: ::|.|.||||.||..:.:.......||:...|
plant    63 HGIFFI-VLGCLLFIPGFYYTRIAYYAYKGYKGFSFSNI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 10/34 (29%)
AT4G29850NP_194714.1 DUF872 <30..101 CDD:399128 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104318
Panther 1 1.100 - - LDO PTHR15664
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.