DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and AT3G29170

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001326507.1 Gene:AT3G29170 / 822567 AraportID:AT3G29170 Length:121 Species:Arabidopsis thaliana


Alignment Length:72 Identity:22/72 - (30%)
Similarity:37/72 - (51%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VPWKTI-IIILLLFIGGIVCIAFATLNWVTDTSRE-RSDRVWALGIIGALTFIPGSYYVYVLFCI 116
            ||||:| :.:.|||:|   |:......::.....| .|.:.:||.::|.|||:||.|...:.:..
plant    45 VPWKSIALAVFLLFLG---CLLLLLSFFIFIGHMEGDSSQGYALLVLGILTFLPGFYETRIAYYS 106

  Fly   117 MLNRNGF 123
            .....|:
plant   107 WRGAEGY 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 10/31 (32%)
AT3G29170NP_001326507.1 DUF872 9..121 CDD:399128 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557903at2759
OrthoFinder 1 1.000 - - FOG0005597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104318
Panther 1 1.100 - - O PTHR15664
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.