DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and AT2G19350

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_565449.1 Gene:AT2G19350 / 816452 AraportID:AT2G19350 Length:103 Species:Arabidopsis thaliana


Alignment Length:104 Identity:29/104 - (27%)
Similarity:46/104 - (44%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YIKVVESQCETDGFVNEQWTEPAMPGPVPWKTIIIILLLFIG--GIVCIAFATLNWVTDTSRERS 89
            |:....|..:.|..:...:|....| ||...::.:.||:| |  |||...|...|.|   ..:|.
plant     3 YVDHAFSISDEDLMIGTSYTVSNRP-PVKEISLAVGLLVF-GTLGIVLGFFMAYNRV---GGDRG 62

  Fly    90 DRVWALGIIGALTFIPGSYYVYVLFCIMLNRNGFTMDEI 128
            ..::.: ::|.|.||||.||..:.:.......||:...|
plant    63 HGIFFI-VLGCLLFIPGFYYTRIAYYAYKGYKGFSFSNI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 10/34 (29%)
AT2G19350NP_565449.1 DUF872 <30..102 CDD:283547 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557903at2759
OrthoFinder 1 1.000 - - FOG0005597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104318
Panther 1 1.100 - - O PTHR15664
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.