DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and Tmem230

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001135443.1 Gene:Tmem230 / 70612 MGIID:1917862 Length:120 Species:Mus musculus


Alignment Length:121 Identity:32/121 - (26%)
Similarity:59/121 - (48%) Gaps:9/121 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAMPGPVPWKTIIIILLLFIGGIVC 72
            ||..|..|    .|:...:|.::..:.   ||:::.|:.:  .|..:|:|.|.:..:||:.|...
Mouse     4 SRTNLATG----LPSSKVKYSRLASTD---DGYIDLQFKK--SPPKIPYKAIALATVLFLIGTFL 59

  Fly    73 IAFATLNWVTDTSRERSDRVWALGIIGALTFIPGSYYVYVLFCIMLNRNGFTMDEI 128
            |...:|......|:..:||...:.|||.|.|:||.|::.:.:.......|::.|:|
Mouse    60 IIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 10/34 (29%)
Tmem230NP_001135443.1 DUF872 <44..118 CDD:368668 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49113
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104318
Panther 1 1.100 - - LDO PTHR15664
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.