powered by:
Protein Alignment CG2611 and Zdhhc14
DIOPT Version :9
Sequence 1: | NP_610043.1 |
Gene: | CG2611 / 35324 |
FlyBaseID: | FBgn0032871 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001034432.1 |
Gene: | Zdhhc14 / 499014 |
RGDID: | 1565877 |
Length: | 489 |
Species: | Rattus norvegicus |
Alignment Length: | 52 |
Identity: | 11/52 - (21%) |
Similarity: | 29/52 - (55%) |
Gaps: | 4/52 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 WVTDTSRERSDRVWALGIIGALTFIPGSYYVYVLFCIM--LNRNGFTMDEIR 129
||.:...:|:.|.:.:.|: :|:|:....:.:|:..:: ..:.|| :|.::
Rat 197 WVGNCVGKRNYRFFYMFIL-SLSFLTVFIFAFVITHVIHRSQQKGF-LDALK 246
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2611 | NP_610043.1 |
DUF872 |
<93..128 |
CDD:283547 |
7/36 (19%) |
Zdhhc14 | NP_001034432.1 |
DHHC |
164..287 |
CDD:396215 |
11/52 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.