DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and zdhhc3a

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001002725.1 Gene:zdhhc3a / 436998 ZFINID:ZDB-GENE-040718-484 Length:316 Species:Danio rerio


Alignment Length:68 Identity:17/68 - (25%)
Similarity:32/68 - (47%) Gaps:16/68 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FVN---EQWTEPAMPGPVPWKTIIIILLLFIGGIVCIAFATLNWVT--------DTSRE---RSD 90
            |:|   :.||:.:...|.  .|:|:::||...|::.:.|.::.:.|        :|..|   |.|
Zfish   192 FLNCFEDDWTKCSTFSPP--ATVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEKLKRED 254

  Fly    91 RVW 93
            ..|
Zfish   255 PTW 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 1/1 (100%)
zdhhc3aNP_001002725.1 zf-DHHC 127..251 CDD:279823 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.