powered by:
Protein Alignment CG2611 and zdhhc3a
DIOPT Version :9
Sequence 1: | NP_610043.1 |
Gene: | CG2611 / 35324 |
FlyBaseID: | FBgn0032871 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002725.1 |
Gene: | zdhhc3a / 436998 |
ZFINID: | ZDB-GENE-040718-484 |
Length: | 316 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 32/68 - (47%) |
Gaps: | 16/68 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 FVN---EQWTEPAMPGPVPWKTIIIILLLFIGGIVCIAFATLNWVT--------DTSRE---RSD 90
|:| :.||:.:...|. .|:|:::||...|::.:.|.::.:.| :|..| |.|
Zfish 192 FLNCFEDDWTKCSTFSPP--ATVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEKLKRED 254
Fly 91 RVW 93
..|
Zfish 255 PTW 257
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.