DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and TMEM230

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_024307647.1 Gene:TMEM230 / 29058 HGNCID:15876 Length:190 Species:Homo sapiens


Alignment Length:120 Identity:25/120 - (20%)
Similarity:47/120 - (39%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPTNSESRH---RLNGGGRSSA---------------------PAGSGEYIKVVESQCETDGFV 41
            :||:...|.|   .|.....|||                     |:...:|.::..:.   ||::
Human    32 LEPSGVISAHCNLHLLASSDSSASASRLCQRVMMPSRTNLATGIPSSKVKYSRLSSTD---DGYI 93

  Fly    42 NEQWTEPAMPGPVPWKTIIIILLLF--------IGGIVCIAFATLNWVTDTSRER 88
            :.|:.:  .|..:|:|.|.:..:||        ||.::...:.:...:..||||:
Human    94 DLQFKK--TPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGSLESTSREQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547
TMEM230XP_024307647.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104318
Panther 1 1.100 - - LDO PTHR15664
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.