DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2611 and dhhc-13

DIOPT Version :9

Sequence 1:	NP_610043.1	Gene:	CG2611 / 35324	FlyBaseID:	FBgn0032871	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_500889.2	Gene:	dhhc-13 / 186797	WormBaseID:	WBGene00019257	Length:	593	Species:	Caenorhabditis elegans

Alignment Length:	126	Identity:	24/126 - (19%)
Similarity:	45/126 - (35%)	Gaps:	47/126 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 SQCE--TDGFVNEQWTEPAMPGPVPW-----------------------KTIIIILLLFIGGIVC 72
            |||:  .|||.:.          .||                       ....::|||::.|
Worm   423 SQCDKCVDGFDHH----------CPWIHKCVYRKNLRAFVFFCLTIFMFHVFYVLLLLYMIG--- 474

  Fly    73 IAFATLNWVTDTSRERSDRVWALGIIGALTFIPGSYYVYVLFCI---MLNRNGFTMDEIRR 130
               |::|   .:..|::.....|.:|..:..||..:....:.|.   .::|:..|::.||:
Worm   475 ---ASMN---ASGFEQTLNDHGLMVISLILAIPHVFGAGAITCTQFSQISRHVSTIEIIRK 529

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2611	NP_610043.1	DUF872	<93..128	CDD:283547	7/37 (19%)
dhhc-13	NP_500889.2	ANK	42..155	CDD:238125
		Ank_2	42..132	CDD:289560
		ANK repeat	67..98	CDD:293786
		ANK repeat	101..132	CDD:293786
		Ank_5	121..176	CDD:290568
		ANK	130..>240	CDD:238125
		Ank_5	198..243	CDD:290568
		ANK repeat	206..234	CDD:293786
		zf-DHHC	405..530	CDD:279823	24/126 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900