powered by:
Protein Alignment CG2611 and dhhc-10
DIOPT Version :9
Sequence 1: | NP_610043.1 |
Gene: | CG2611 / 35324 |
FlyBaseID: | FBgn0032871 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508805.3 |
Gene: | dhhc-10 / 180745 |
WormBaseID: | WBGene00019344 |
Length: | 327 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 15/50 - (30%) |
Similarity: | 26/50 - (52%) |
Gaps: | 6/50 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 PGPVPWKTII--IILLLFIGGIVC-IAFATLNWVTDTSRER--SD-RVWA 94
|..:.|.|:: :|:|.....:.| :.:|..|.||...|:. :| ||:|
Worm 49 PTHIYWLTLVAKLIILEIAVNLACFVYYARYNSVTYWHRKSCVADLRVYA 98
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2611 | NP_610043.1 |
DUF872 |
<93..128 |
CDD:283547 |
0/1 (0%) |
dhhc-10 | NP_508805.3 |
zf-DHHC |
129..270 |
CDD:279823 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.