DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2611 and tmem230b

DIOPT Version :9

Sequence 1:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001096110.1 Gene:tmem230b / 100124614 ZFINID:ZDB-GENE-070820-4 Length:115 Species:Danio rerio


Alignment Length:129 Identity:31/129 - (24%)
Similarity:56/129 - (43%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SRHRLNGGGRSSAPAGSGEYIKVVESQCETDGFVNEQWTEPAMPGPVPWKTIIII--------LL 64
            :|..:|.|.|.|..|.            :.||:::.|:..  .|..||:|.|.:.        :|
Zfish     3 ARSTINSGVRYSKLAS------------DDDGYIDLQFKR--SPPKVPYKAIALATGLFLIGSIL 53

  Fly    65 LFIGGIVCIAFATLNWVTDTSRERSDRVWALGIIGALTFIPGSYYVYVLFCIMLNRNGFTMDEI 128
            :.||.::...:..:|       :..||...:.|||.|.|:||.|::.:.:.......|::.|:|
Zfish    54 IIIGSLLLAGYFEVN-------DHRDRTIPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 10/34 (29%)
tmem230bNP_001096110.1 DUF872 <78..113 CDD:283547 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49113
OrthoDB 1 1.010 - - D1557903at2759
OrthoFinder 1 1.000 - - FOG0005597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104318
Panther 1 1.100 - - LDO PTHR15664
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.