DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2608 and SPAG7

DIOPT Version :9

Sequence 1:NP_610042.1 Gene:CG2608 / 35323 FlyBaseID:FBgn0032870 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_004881.2 Gene:SPAG7 / 9552 HGNCID:11216 Length:227 Species:Homo sapiens


Alignment Length:238 Identity:87/238 - (36%)
Similarity:150/238 - (63%) Gaps:20/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLLDSILNAMDAPPANNEQQ-KTLIKKQREMLERMQNKQKEELLRFRKYVDERMGRFAKDDRRC- 64
            |||.|||::|:.||:..:|: :...::|...|:::|.::|::.:.|||.:::.:..|.:|..:. 
Human     3 DLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIK 67

  Fly    65 IEFQPLDKVHRSVIHEVAENGGFIAMSFGREDVDRHSVVYKKEHAPGEDEVTARRNGDGWNEEIA 129
            .:|||::|:.||::|:|.|..|..:.|||.:|..|:.:::|||.||.::|:.:.|.|:.|:.:.|
Human    68 KKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKA 132

  Fly   130 KEYAERRRERLAQEQSDKEASTSEAASSGSSTSTSADQDSGEVKPTTNYKAKYAHLIGESAALQA 194
            :|  :|:.:.|||.|.:      |||..|...          |.|.::||.||:||||:.||..|
Human   133 EE--KRKLKELAQRQEE------EAAQQGPVV----------VSPASDYKDKYSHLIGKGAAKDA 179

  Fly   195 ARKTETNQSYGFVPSKNKKDVRSIEQTLADIQAKKRLRLAQQQ 237
            |...:.|::||.||..||:|.||||:.:.:|:||||||.:.::
Human   180 AHMLQANKTYGCVPVANKRDTRSIEEAMNEIRAKKRLRQSGEE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2608NP_610042.1 R3H_sperm-antigen 47..106 CDD:100065 19/59 (32%)
SPAG7NP_004881.2 DUF106 <1..>76 CDD:418652 22/72 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 14/42 (33%)
Nuclear localization signal. /evidence=ECO:0000255 35..51 4/15 (27%)
R3H_sperm-antigen 49..109 CDD:100065 19/59 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..160 15/59 (25%)
Nuclear localization signal. /evidence=ECO:0000255 122..139 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143139
Domainoid 1 1.000 92 1.000 Domainoid score I7624
eggNOG 1 0.900 - - E1_28PDV
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3595
Inparanoid 1 1.050 162 1.000 Inparanoid score I4223
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49694
OrthoDB 1 1.010 - - D1416114at2759
OrthoFinder 1 1.000 - - FOG0008421
OrthoInspector 1 1.000 - - oto91649
orthoMCL 1 0.900 - - OOG6_108973
Panther 1 1.100 - - LDO PTHR13498
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5463
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.