DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phr6-4 and phr

DIOPT Version :9

Sequence 1:NP_001260632.1 Gene:phr6-4 / 35322 FlyBaseID:FBgn0016054 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_523653.2 Gene:phr / 35735 FlyBaseID:FBgn0003082 Length:555 Species:Drosophila melanogaster


Alignment Length:544 Identity:114/544 - (20%)
Similarity:191/544 - (35%) Gaps:156/544 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSQRSTLVHWFRKGLRLHDNPALSHIFTAANAAPGKYFVRPIFILDPGILDWMQVGANRWRFLQQ 66
            :|....:|:|..:..|:.||.||  :|....|...:..:..:|.|.|..|:   .....::|:..
  Fly   111 ESSLGGVVYWMSRDGRVQDNWAL--LFAQRLALKLELPLTVVFCLVPKFLN---ATIRHYKFMMG 170

  Fly    67 TLEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKA--- 128
            .|::::.|.|.|:....::.|...|..|:..||..:..:.  .|..|..:.|. .|:.:.||   
  Fly   171 GLQEVEQQCRALDIPFHLLMGSAVEKLPQFVKSKDIGAVV--CDFAPLRLPRQ-WVEDVGKALPK 232

  Fly   129 --EGVRVETH--------------CSHTIYNPELVIAKNLGKAPITYQKFLGIVEQLKV-PKVLG 176
              ..|:|:.|              .:.||.|.   |...||             |.|.| |.|:.
  Fly   233 SVPLVQVDAHNVVPLWVASDKQEYAARTIRNK---INSKLG-------------EYLSVFPPVVR 281

  Fly   177 VPE--KLKNMPTPPKDEVEQKDSAAYDCPTMKQLVKRPEELGPNKFPGGETEALRRMEESLKDEI 239
            .|.  ..||:.|     |:.  ||||........|...:...|     |...|.:::.|.....:
  Fly   282 HPHGTGCKNVNT-----VDW--SAAYASLQCDMEVDEVQWAKP-----GYKAACQQLYEFCSRRL 334

  Fly   240 WVARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQPPVSLIGQLMWRE 304
              ..|......|.:  .:.:.|||:|.||.:||:   :...|:.:.:.:|.....:...:.:.| 
  Fly   335 --RHFNDKRNDPTA--DALSGLSPWLHFGHISAQ---RCALEVQRFRGQHKASADAFCEEAIVR- 391

  Fly   305 FYYTVAAAEPNFDRMLGNVYCMQIPWQEHPDHLE---AWTHGRTGYPFIDAIMRQLRQEGW-IHH 365
                         |.|.:.:|.   :.||.|.|:   :|     .|..:||..:..|...: :..
  Fly   392 -------------RELADNFCF---YNEHYDSLKGLSSW-----AYQTLDAHRKDKRDPCYSLEE 435

  Fly   366 LARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGK 430
            |.:.     ||..|||.|        .||.|.::..:              |.:.|:|    :.|
  Fly   436 LEKS-----LTYDDLWNS--------AQLQLVREGKM--------------HGFLRMY----WAK 469

  Fly   431 K----TDPQGHYIRKYVPELSKYP---------AGCIYE-------PWKASLVDQRAYGCVLGTD 475
            |    |....|.:...:....||.         .||::.       .||    ::..:|.|...:
  Fly   470 KILEWTATPEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWK----ERAIFGKVRYMN 530

  Fly   476 YPHRIVKHEV----------VHKE 489
            |.....|.:|          |||:
  Fly   531 YQGCRRKFDVNAFVMRYGGKVHKK 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phr6-4NP_001260632.1 PhrB 5..499 CDD:223492 113/541 (21%)
FAD_binding_7 297..496 CDD:377037 44/227 (19%)
phrNP_523653.2 phr2 93..547 CDD:129679 111/535 (21%)
DNA_photolyase 117..278 CDD:279247 41/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0415
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.