DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phr6-4 and CG18853

DIOPT Version :9

Sequence 1:NP_001260632.1 Gene:phr6-4 / 35322 FlyBaseID:FBgn0016054 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster


Alignment Length:376 Identity:65/376 - (17%)
Similarity:113/376 - (30%) Gaps:167/376 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 EESLKDEIWVARFEKPN----------TAPNSLEPSTTVLSPYLKFGCLSARLFNQKLKEII--- 283
            |:.||.::.:||.|..|          .....:|..|.:|..:...||.:.   |:..|:.:   
  Fly     3 EDDLKSQLTIARNEINNLRQQVRNLQHVQRKDIETITRLLQDFRCEGCANN---NKSAKDKVAGE 64

  Fly   284 KRQPKHSQ--------------------------------------------PPVSLIG------ 298
            |::.:|.|                                            |..|::|      
  Fly    65 KQEHQHQQQTQDQQTGQGQSNYTNGGHCLGEDYAHFRPIGVIRTAFPEKRAVPRQSIVGSRLRGI 129

  Fly   299 -QL--------------------MWREFYYTVAAAEPNFDRMLGNVYCMQIPWQEHPDHLE---A 339
             ||                    :|..:::....:.|   :...:.:|.   :.||.|.|:   :
  Fly   130 IQLNDGVFTNPEHSLEGLEDFSHLWLIYHFHRNNSHP---KAKADNFCF---YNEHYDSLKGLSS 188

  Fly   340 WTHGRTGYPFIDAIMRQLRQEGW-IHHLARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALN 403
            |     .|..:||..:..|...: :..|.:.     ||..|||.|        .||.|.::..: 
  Fly   189 W-----AYQTLDAHRKDKRDPCYSLEELEKS-----LTYDDLWNS--------AQLQLVREGKM- 234

  Fly   404 AGNWMWLSASAFFHQYFRVYSPVAFGKK----TDPQGHYIRKYVPELSKYP---------AGCIY 455
                         |.:.|:|    :.||    |....|.:...:....||.         .||::
  Fly   235 -------------HGFLRMY----WAKKILEWTATPEHALEYAILLNDKYSLDGRDPNGYVGCMW 282

  Fly   456 E-------PWKASLVDQRAYGCVLGTDYPHRIVKHEV----------VHKE 489
            .       .||    ::..:|.|...:|.....|.:|          |||:
  Fly   283 SIGGVHDMGWK----ERAIFGKVRYMNYQGCRRKFDVNAFVMRYGGKVHKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phr6-4NP_001260632.1 PhrB 5..499 CDD:223492 65/376 (17%)
FAD_binding_7 297..496 CDD:377037 46/254 (18%)
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 6/62 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0415
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.