DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17472 and Muc14A

DIOPT Version :10

Sequence 1:NP_610040.1 Gene:CG17472 / 35320 FlyBaseID:FBgn0032868 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster


Alignment Length:160 Identity:38/160 - (23%)
Similarity:62/160 - (38%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NLGFALSSKEYDEHERLVTW-----RLRNIVNKYKYL---ATGNAEFSRWIEKVNNAAARSNL-- 65
            ||....||:..|.:    .|     ||.::.|||...   :..|:||.....::|::...:.|  
  Fly 15903 NLILTASSQPTDVN----VWKEIDKRLDDLQNKYTIRDNNSLDNSEFKEKFSQINSSIHLNQLPG 15963

  Fly    66 EVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRSLISLRKGGKRCVRFYQHQENELKNAYKFSNQK 130
            .::......|.:||:.|..||..|..:||.:...:...|....|:..|::....|..:...||.:
  Fly 15964 NIRASLYANFTIYDKIRIELEAIILFKLNQILENLKATKSTPACIDHYKYIAKNLVTSLAMSNTE 16028

  Fly   131 KEEVFVNS-----------LKKCFAPPAIQ 149
            |..|...|           :.|...||..|
  Fly 16029 KWNVIRKSHLICHITQNTTVTKPSLPPTTQ 16058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17472NP_610040.1 None
Muc14ANP_727928.3 ser_rich_anae_1 8473..>8784 CDD:468206
PRK12323 <11126..11491 CDD:481241
PRK12323 <11377..11776 CDD:481241
PRK08581 11922..>12215 CDD:236304
PRK12323 <14663..15055 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.