DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17472 and CG43090

DIOPT Version :10

Sequence 1:NP_610040.1 Gene:CG17472 / 35320 FlyBaseID:FBgn0032868 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001245546.1 Gene:CG43090 / 12798122 FlyBaseID:FBgn0262536 Length:169 Species:Drosophila melanogaster


Alignment Length:145 Identity:48/145 - (33%)
Similarity:72/145 - (49%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IIALLVLANLGFALSSKEYDEHERLVTWRLRNIVNKYKYLATGNAEFSRWIEKV-----NNAAAR 62
            |..||:|..:.....|:|..|.:..||.:|::.:..:......|.||..||.|:     ||:   
  Fly     4 IWTLLLLGLVTAQGPSEEIAEIDAEVTKKLKSFLENFTGYWKDNTEFLNWIAKIRLALNNNS--- 65

  Fly    63 SNLEVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRSLISLRKGGKRCVRFYQHQENELKNAYKFS 127
            ::|..|.:....|:.|:::|.:||..|..|:..|.|:|..:|..| |:.||..|.|.||.|.|.|
  Fly    66 TDLAYKFELRYGFESYNKERLVLEQQILDRVEDLDSIIPHQKHAK-CLNFYVDQRNALKTALKQS 129

  Fly   128 NQKKEEVFVNSLKKC 142
            |.||.|.|..:...|
  Fly   130 NSKKIERFAENSPSC 144

Return to query results.
Submit another query.