DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2493 and Dpp7

DIOPT Version :9

Sequence 1:NP_001260630.1 Gene:CG2493 / 35316 FlyBaseID:FBgn0032864 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_114179.1 Gene:Dpp7 / 83799 RGDID:71073 Length:500 Species:Rattus norvegicus


Alignment Length:490 Identity:190/490 - (38%)
Similarity:272/490 - (55%) Gaps:38/490 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DMGEATVRAALLAVLGIL-LIAGCDCSQRFKYEIKEFQVPLDHFSF--LINATFNIRYLYNDSFV 66
            |.|..:....||..||:. |.|..|......:....|:..:|||:|  ..|.||..|:|.:|.|.
  Rat    10 DHGVPSWVLVLLLTLGLCSLQATADSVLDPDFRENYFEQYMDHFNFESFSNKTFGQRFLVSDKFW 74

  Fly    67 DKSNARTPIFFYTGNEGDIELFAQNTGFLWEQAERQRALVIFAEHRYYGKSLPFGSSTFNTSLPE 131
            .....  ||||||||||||...|.|:||:.|.|.:|.||::||||||||||||||..:......:
  Rat    75 KMGEG--PIFFYTGNEGDIWSLANNSGFIVELAAQQEALLVFAEHRYYGKSLPFGVQSTQRGYTQ 137

  Fly   132 HLAYFTVEQTLEDYAMLITFLRND---RQMPVVAFGGSYGGMLAAWFRMKYPHLVNGALAASAPV 193
            .|   ||||.|.|:|:|:..||::   :..|.:||||||||||:|:.||||||||.|||||||||
  Rat   138 LL---TVEQALADFAVLLQALRHNLGVQDAPTIAFGGSYGGMLSAYMRMKYPHLVAGALAASAPV 199

  Fly   194 LQFPGITDCDIFYRIVTSVFQNAYNEN--CTLNIAKSWKLFETL---GASEAGKKQISDAFHLCN 253
            :...|:.:.|.|:|.||:.|   |.::  |...:..:::..:.|   ||.:.    ||..|..|.
  Rat   200 IAVAGLGNPDQFFRDVTADF---YGQSPKCAQAVRDAFQQIKDLFLQGAYDT----ISQNFGTCQ 257

  Fly   254 ALKNDDDLKKFLDYVEEVYSNLAMVNYPYNSSFLAPLPAYPVRQVCYYLKELHSTDADLLHAMSS 318
            :|.:..||.:...:....::.|||::|||.::||.||||.||:..|   :.|.|....::...:.
  Rat   258 SLSSPKDLTQLFGFARNAFTVLAMMDYPYPTNFLGPLPANPVKVGC---ERLLSEGQRIMGLRAL 319

  Fly   319 ALAVYTNYTQSAKCLDI--SVNSNADDSG---------WNIQSCNQMVMPICSNGSETMFRTSSW 372
            |..|| |.:....|.||  ...|.||.:|         |:.|:|.::.:...||....||....:
  Rat   320 AGLVY-NSSGMEPCFDIYQMYQSCADPTGCGTGSNARAWDYQACTEINLTFDSNNVTDMFPEIPF 383

  Fly   373 NFKDYAEKCYKNYRLTPKPYDIILRYGGRNLEAATNIIFSNGLLDPWSGGGVLQAPNDKVFVIIL 437
            :.:...:.|...:.:.|:|..:...:.|.:|:||:|||||||.||||:|||:.:..:..:..:.:
  Rat   384 SDELRQQYCLDTWGVWPRPDWLQTSFWGGDLKAASNIIFSNGDLDPWAGGGIQRNLSTSIIAVTI 448

  Fly   438 PEGAHHLDLRHSDPADPPSVRDARDKEAAIIARWI 472
            ..||||||||.|:..|||||.:.|..||.:|..|:
  Rat   449 QGGAHHLDLRASNSEDPPSVVEVRKLEATLIREWV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2493NP_001260630.1 Abhydrolase 43..464 CDD:304388 176/441 (40%)
Dpp7NP_114179.1 Abhydrolase 48..475 CDD:304388 176/442 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55283
OrthoDB 1 1.010 - - D245747at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.