DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2493 and AT3G28680

DIOPT Version :9

Sequence 1:NP_001260630.1 Gene:CG2493 / 35316 FlyBaseID:FBgn0032864 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_189509.1 Gene:AT3G28680 / 822498 AraportID:AT3G28680 Length:199 Species:Arabidopsis thaliana


Alignment Length:192 Identity:57/192 - (29%)
Similarity:89/192 - (46%) Gaps:21/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 FGGSYGGMLAAWFRMKYPHLVNGALAASAPVLQFPGITDCDIFYRIVTSVFQNAYNENCTLNIAK 227
            |.|:...:|||||::|||::..||||:|||:|.|........::.|||.||:....| |...|.|
plant    16 FHGAVHKVLAAWFKLKYPYIALGALASSAPLLYFEDTLPKHGYFYIVTKVFKEMSKE-CHNKIHK 79

  Fly   228 SWKLFETLGASEAGKKQISDAFHLCNALKNDDDLKKFLDYVEEVYSNLAMVNYPYNSSFLAPLPA 292
            ||...:.:.|.......:|..|.|||.|.:..:||.::.|   :|:..|  .|..|.        
plant    80 SWDEIDRIAAKPNSLSILSKNFKLCNPLNDIIELKSYVSY---IYARTA--QYSDNQ-------- 131

  Fly   293 YPVRQVCYYLK-ELHSTDADLLHAMSSALAVYTNYTQSAKCLDISVNS---NADDSGWNIQS 350
            :.|.::|..:. ...:|.:|||..:.:.:.....   :..|..:|..|   ..||..|..|:
plant   132 FSVARLCEAINTSPPNTKSDLLDQIFAGVVASRG---NISCYGMSSPSYQMTNDDRAWGWQT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2493NP_001260630.1 Abhydrolase 43..464 CDD:304388 57/192 (30%)
AT3G28680NP_189509.1 Abhydrolase <7..>190 CDD:304388 56/190 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D555765at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.