DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2493 and CG3739

DIOPT Version :9

Sequence 1:NP_001260630.1 Gene:CG2493 / 35316 FlyBaseID:FBgn0032864 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_650804.2 Gene:CG3739 / 42320 FlyBaseID:FBgn0038702 Length:485 Species:Drosophila melanogaster


Alignment Length:486 Identity:129/486 - (26%)
Similarity:207/486 - (42%) Gaps:92/486 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RFKYEIKEFQVPLDHFSFLINATFNIR-YLYNDSFVDKSNARTPIFFYTGNEGDIELFAQNTGFL 95
            |.|.|.:.....||:|....|||:..| |:.|..|||.|    |||.|.|.|..|:.....:| |
  Fly    49 RAKVEERWITQKLDNFDDSNNATWQDRIYINNKYFVDGS----PIFIYLGGEWAIDPSGITSG-L 108

  Fly    96 WEQ-AERQRALVIFAEHRYYGKSLPFGSSTFNTSL-PEHLA-YFTVEQTLEDYAMLITFLRND-- 155
            |:. |::....:::.|||::|:|:|.      |.| .|:|| |.:|||.|.|...:|..|:.:  
  Fly   109 WKDIAKQHNGSLLYTEHRFFGQSIPI------TPLSTENLAKYQSVEQALADVINVIATLKQEDK 167

  Fly   156 -RQMPVVAFGGSYGGMLAAWFRMKYPHLVNGALAASAPVLQFPGITDCDIFYRIVTSVFQNAYNE 219
             :...||..|.||...:|.|.|..||.::.|:.|:|||:|......|   :.::|...:.....:
  Fly   168 YKDSKVVVSGCSYSATMATWIRKLYPEIIRGSWASSAPLLAKVNFKD---YMKVVGESYATLGGQ 229

  Fly   220 NC--TLNIAKSW--KLFETLGASEAGKKQISDAFHLCN--ALKNDDDLKKFLDYVEEVYSNLAMV 278
            .|  .::.|.|:  .|||....::|.|:     .:||:  .:.::.|..:....:..:::.:|..
  Fly   230 YCYDLIDNATSYYENLFEIGNGTQAVKE-----LNLCSNFNVNSEQDRWQIFSTIANIFAGIAQY 289

  Fly   279 NYPYNSSFLAPLPAYPVRQVCYYLKELHSTDADLLHAMSSALAVYTNY---TQSAKCLDISV--- 337
            ..|         ..|.:...|..|:|....|       |.||:.:.|:   ..|..||..:.   
  Fly   290 QKP---------EKYDIPTYCSILREFSDDD-------SVALSKFINWKINEHSGACLSTTFKGA 338

  Fly   338 ---------NSNADDSGWNIQSCNQMVMPICSNGSETMFRTSSWNFKDYAEKC------------ 381
                     |....|..|..|:|::... ..|:||.:....|::....|.:.|            
  Fly   339 VGYYEWSKENYQDSDLPWIFQTCSEFGW-FQSSGSRSQPFGSTFPATLYEDTCEGVFGAKYDSAG 402

  Fly   382 -YKNYRLTPKPYDIILRYGGRNLEAATNIIFSNGLLDPWS--GGGVLQAPNDKVFVIILPEGAHH 443
             :.|.|.|...      :||.|:. ||||.|..|.||.||  |.||.|.      ..|:|..:|.
  Fly   403 IHANIRATNDD------FGGLNVN-ATNIYFVQGALDGWSKVGAGVAQG------ATIIPYASHC 454

  Fly   444 LDLRHSDPADPPSVRDARDKEAAIIARWIQD 474
            .|......:|...:..::.|...::|:|::|
  Fly   455 PDTGSISASDSAELVASKKKLIKLVAQWLED 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2493NP_001260630.1 Abhydrolase 43..464 CDD:304388 122/463 (26%)
CG3739NP_650804.2 Peptidase_S28 59..475 CDD:253262 122/464 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D555765at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11010
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.