DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc23 and ALA1

DIOPT Version :9

Sequence 1:NP_001260629.1 Gene:Cdc23 / 35315 FlyBaseID:FBgn0032863 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_014980.3 Gene:ALA1 / 854513 SGDID:S000005862 Length:958 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:45/237 - (18%)
Similarity:85/237 - (35%) Gaps:82/237 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SYMAREKRRLDSTTDQANLHEP---------NQMR------------DLADLLATLRMEYGKSRL 154
            |.:|.||.|.|.:..:|..:|.         .|::            |||..:..:|..:|::..
Yeast   623 SLVAPEKLRFDFSHKKAVSNEELKKVEDICNEQIKENLQVFYKEIPLDLAKSIDGVRAVFGETYP 687

  Fly   155 DGYGIYLYGVVLKALNLNQAAEQMLVQAIRLVPMLWSAYLELSPLIMEKKKLLSLQL-GGHWMRH 218
            |...:...|..::.|..|.|.|:            |:.|              |::. ||     
Yeast   688 DPVRVVSVGKPIEELLANPANEE------------WTKY--------------SIEFCGG----- 721

  Fly   219 FFMAHTYLELYLNDDG-LKIYEDLQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQALLESDPY 282
                     .::|..| :|.:..|:.||.:|.|..|..:.           ..|.::|...::.:
Yeast   722 ---------THVNKTGDIKYFVILEESGIAKGIRRIVAVT-----------GTEAFEAQRLAEQF 766

  Fly   283 RLDNVDTYSNLLF-------VKEMKTEMAQLAHKAVSINKYR 317
            ..| :|....|.|       :||:..::.||:...::.|:.:
Yeast   767 AAD-LDAADKLPFSPIKEKKLKELGVKLGQLSISVITKNELK 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc23NP_001260629.1 ANAPC8 11..119 CDD:281973 4/7 (57%)
TPR 235..507 CDD:223533 18/90 (20%)
TPR repeat 255..278 CDD:276809 2/22 (9%)
TPR repeat 318..346 CDD:276809 45/237 (19%)
TPR repeat 351..381 CDD:276809
TPR repeat 386..414 CDD:276809
TPR repeat 420..448 CDD:276809
TPR repeat 454..477 CDD:276809
TPR repeat 494..522 CDD:276809
ALA1NP_014980.3 PLN02900 7..946 CDD:215487 45/237 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0013
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.