DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc23 and AT3G16565

DIOPT Version :10

Sequence 1:NP_610036.2 Gene:Cdc23 / 35315 FlyBaseID:FBgn0032863 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001325974.1 Gene:AT3G16565 / 820906 AraportID:AT3G16565 Length:289 Species:Arabidopsis thaliana


Alignment Length:60 Identity:15/60 - (25%)
Similarity:24/60 - (40%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VHIDNEAPDEDRTFSECQLEGIAPEEYSDYFLAKSYYDVREYDRAAHAVRNCESSVPRFL 106
            |......|.|:....:.:||..|.|..|..  .|.|..:..|:.|:..   |..|:|.::
plant   182 VEYKGSVPQEEFQVKQKELEAEANELISKG--GKVYAAILPYEEASVL---CGGSLPDYI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc23NP_610036.2 ANAPC8 13..119 CDD:427675 15/60 (25%)
LapB 255..521 CDD:442196
TPR repeat 255..278 CDD:276809
TPR repeat 318..346 CDD:276809
TPR repeat 351..381 CDD:276809
TPR repeat 386..414 CDD:276809
TPR repeat 420..448 CDD:276809
TPR repeat 454..477 CDD:276809
TPR repeat 494..522 CDD:276809
AT3G16565NP_001325974.1 PLN02961 32..287 CDD:178546 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.