Sequence 1: | NP_001260629.1 | Gene: | Cdc23 / 35315 | FlyBaseID: | FBgn0032863 | Length: | 678 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261503.1 | Gene: | Cdc27 / 38798 | FlyBaseID: | FBgn0012058 | Length: | 900 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 66/266 - (24%) |
---|---|---|---|
Similarity: | 136/266 - (51%) | Gaps: | 46/266 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 SIYLIAQMALVYHNKRDVDKAIELYQALLESDPYRLDNVDTYSNLLFVKEMKTEMAQLAHKAVSI 313
Fly 314 NKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNPKYLAAWTLMGHEFMELKNTNAAIQSYRKA 378
Fly 379 VEVNKRDYRAWYGLG------QAYEIIKMHYYSLYYFKIAHQLRPYDSRMLVAL----------- 426
Fly 427 -----------------------GETYEKLDKCENAVKCYWKAIDVGDIEGIAMYKLANLHEKLG 468
Fly 469 DHETAV 474 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cdc23 | NP_001260629.1 | ANAPC8 | 11..119 | CDD:281973 | |
TPR | 235..507 | CDD:223533 | 66/266 (25%) | ||
TPR repeat | 255..278 | CDD:276809 | 3/22 (14%) | ||
TPR repeat | 318..346 | CDD:276809 | 13/27 (48%) | ||
TPR repeat | 351..381 | CDD:276809 | 9/29 (31%) | ||
TPR repeat | 386..414 | CDD:276809 | 11/33 (33%) | ||
TPR repeat | 420..448 | CDD:276809 | 8/61 (13%) | ||
TPR repeat | 454..477 | CDD:276809 | 5/21 (24%) | ||
TPR repeat | 494..522 | CDD:276809 | |||
Cdc27 | NP_001261503.1 | ANAPC3 | 16..94 | CDD:289650 | |
TPR_11 | 67..145 | CDD:290150 | |||
TPR repeat | 68..104 | CDD:276809 | |||
TPR repeat | 109..143 | CDD:276809 | |||
TPR_12 | 539..601 | CDD:290160 | 4/24 (17%) | ||
TPR repeat | 582..605 | CDD:276809 | 3/22 (14%) | ||
TPR | 590..850 | CDD:223533 | 64/252 (25%) | ||
TPR_1 | 645..678 | CDD:278916 | 14/32 (44%) | ||
TPR repeat | 678..708 | CDD:276809 | 9/29 (31%) | ||
TPR_1 | 713..746 | CDD:278916 | 12/38 (32%) | ||
TPR repeat | 713..741 | CDD:276809 | 11/33 (33%) | ||
TPR repeat | 747..773 | CDD:276809 | 3/25 (12%) | ||
TPR repeat | 781..809 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 815..838 | CDD:276809 | 5/21 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45449294 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12558 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |