DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc23 and AlaRS-m

DIOPT Version :9

Sequence 1:NP_001260629.1 Gene:Cdc23 / 35315 FlyBaseID:FBgn0032863 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_523932.2 Gene:AlaRS-m / 38595 FlyBaseID:FBgn0028962 Length:1012 Species:Drosophila melanogaster


Alignment Length:176 Identity:35/176 - (19%)
Similarity:78/176 - (44%) Gaps:52/176 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 VVLKALNLNQ---AAEQMLVQAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTY 225
            |:.||||:::   |.:::|.|   |||::.....|..|.:..|::.:                  
  Fly   332 VLRKALNISEHVFAHDKLLTQ---LVPIVVETLGEAYPEMAAKQQAV------------------ 375

  Fly   226 LELYLNDDGLKIYEDLQASGFSKSIYLIAQMALVYHNKRDVD-----------KAIELYQALLES 279
            ::|..::.  ::|::|:.|. ||:   .|::.:.:.|..|:|           :.:::.:....:
  Fly   376 IDLICHEQ--EVYKNLRESS-SKA---FAEVLMEFPNLDDIDLMECPGFVPAYRELQMQRCKFSN 434

  Fly   280 DP------YRLDNVDTYSNLLFVKEMKTEMAQLAHKAVSINKYRPE 319
            :.      |:|  .|||.   ..:|...::|:|.:....:.:||.|
  Fly   435 NTIPGDFLYKL--TDTYG---LTEESFLKLAELENMNCDLERYRAE 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc23NP_001260629.1 ANAPC8 11..119 CDD:281973
TPR 235..507 CDD:223533 20/102 (20%)
TPR repeat 255..278 CDD:276809 3/33 (9%)
TPR repeat 318..346 CDD:276809 1/2 (50%)
TPR repeat 351..381 CDD:276809
TPR repeat 386..414 CDD:276809
TPR repeat 420..448 CDD:276809
TPR repeat 454..477 CDD:276809
TPR repeat 494..522 CDD:276809
AlaRS-mNP_523932.2 PLN02900 13..1010 CDD:215487 35/176 (20%)
AlaRS_core 14..261 CDD:238360
tRNA_SAD 570..>667 CDD:298782
tRNA_SAD 748..>784 CDD:197931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0013
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.