DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc23 and APC7

DIOPT Version :9

Sequence 1:NP_001260629.1 Gene:Cdc23 / 35315 FlyBaseID:FBgn0032863 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_572329.3 Gene:APC7 / 31594 FlyBaseID:FBgn0029879 Length:615 Species:Drosophila melanogaster


Alignment Length:654 Identity:128/654 - (19%)
Similarity:210/654 - (32%) Gaps:215/654 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YFLAKSYYD------VREYDRAAHAVR-----------NCESSVPRFLHFYSSYMAREKRRLDST 123
            |.|..:|.:      :|.:|...|..|           ..|||.|.|........|.|..|....
  Fly    60 YLLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGN 124

  Fly   124 TDQA---NLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV--QAI 183
            ||.|   .|..|..:|.....|...|:::..||        :|...|       :|.:|.  :.|
  Fly   125 TDMAIETLLQVPPTLRSPRINLMLARLQHHGSR--------HGTTKK-------SEAVLAYKEVI 174

  Fly   184 RLVPM---LWSAYLEL-------SPLIMEKKKLLSLQLGGH--WM-------------RHFFMAH 223
            |..||   :..|.|||       :.|:|.     :..:..|  |:             :|...:.
  Fly   175 RECPMALQVIEALLELGVNGNEINSLVMH-----AATVPDHFDWLSKWIKALAQMFNFKHSDASQ 234

  Fly   224 TYLELYLNDDGLKIYEDLQASGFSKSIYLIAQMAL---VYHNKRDVDKAIELYQALLESDPYRLD 285
            |:|.|:.|.. |:..|.|             .|||   :|:| .|..:|.:::.:.|.::|   |
  Fly   235 TFLMLHDNTT-LRCNEHL-------------MMALGKCLYYN-GDYFQAEDIFSSTLCANP---D 281

  Fly   286 NVDTYSNLLFV-------KEMKTEMAQLAHKAVSINKYRPETCCVIGNYYSIRCDHQVAISYFQR 343
            ||:....:..:       ::...:|..|..|..|..||..................:..:::.::
  Fly   282 NVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEK 346

  Fly   344 ALKLNPKYLAAWTLMGHEFMELKNTNAAIQSYRKAVEVNKRDYRAWYGLGQAYEIIKMHYYSLYY 408
            .|...|:...|..|.|...:.|:....|:.::|.|..|....:..:.||..:|...|.       
  Fly   347 CLDSEPRNHEALILRGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKR------- 404

  Fly   409 FKIAHQLRPYDSRMLVALGETYEKLDK-----------------CENAVK---CYWKAI----DV 449
            ||.|:.|..:..|:......::....:                 .|.::|   .|..|:    |:
  Fly   405 FKEANALCNWTIRLFQNSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADI 469

  Fly   450 GDIEG------------IAMYKLANLHEKLGDHETAVHCYIMYCEDERAATDKQSLYQGFITLAN 502
            ..:||            :.::...||...|||        ||                       
  Fly   470 CQVEGPTKAIIKLLEKHVIIFPKVNLLNHLGD--------IM----------------------- 503

  Fly   503 YYEKKGEYERAAYYAYKCLDSEDRKMEAKALLKTIDWKRNAEGQKKVKTSTAVANADTSS----- 562
              .|:.|..:|..|.||.|..:.:.            ||...|.:      .:|.:|..|     
  Fly   504 --RKQKEPVKAMEYYYKALRQDPKS------------KRTLRGLR------LLAKSDDESPVLDE 548

  Fly   563 EDEMEWELQDVRVRVPITSIATTTTSTTTVAAESASSSSLISLRPDRNLIQGMRRSQSSRTSLTA 627
            .|::..:.|.     .|..:.|...:|....||.|.|            ::..|.:.||    .|
  Fly   549 SDDIGMDNQQ-----SINDLTTLCEATNAQGAEGAES------------VENSREASSS----AA 592

  Fly   628 PASG 631
            ..||
  Fly   593 ARSG 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc23NP_001260629.1 ANAPC8 11..119 CDD:281973 14/59 (24%)
TPR 235..507 CDD:223533 54/317 (17%)
TPR repeat 255..278 CDD:276809 7/25 (28%)
TPR repeat 318..346 CDD:276809 0/27 (0%)
TPR repeat 351..381 CDD:276809 7/29 (24%)
TPR repeat 386..414 CDD:276809 7/27 (26%)
TPR repeat 420..448 CDD:276809 5/51 (10%)
TPR repeat 454..477 CDD:276809 6/34 (18%)
TPR repeat 494..522 CDD:276809 6/27 (22%)
APC7NP_572329.3 TPR repeat 251..277 CDD:276809 8/39 (21%)
TPR_11 321..386 CDD:290150 10/64 (16%)
TPR repeat 321..349 CDD:276809 0/27 (0%)
TPR repeat 354..384 CDD:276809 7/29 (24%)
TPR_11 356..418 CDD:290150 16/68 (24%)
TPR repeat 459..489 CDD:276809 5/29 (17%)
TPR repeat 493..521 CDD:276809 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12558
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.