DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31688 and SPAC4A8.02c

DIOPT Version :9

Sequence 1:NP_610035.4 Gene:CG31688 / 35314 FlyBaseID:FBgn0263355 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_593813.1 Gene:SPAC4A8.02c / 2543398 PomBaseID:SPAC4A8.02c Length:142 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:70/134 - (52%)
Similarity:95/134 - (70%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QRKINLRPQHRGVHLVTEEILRQMPELAHFSVGLCHMQILHTSASLALNESWDPDVRDDMEMMLN 103
            ||.|.|..:.:|.:::|.::::::|||..||.|..:..|.||||:|.:||:||.|.|.||..:|:
pombe     5 QRIITLDRRSKGFYIITNDLVKKLPELKSFSSGTVNFFIQHTSAALTINENWDADTRADMNDILD 69

  Fly   104 KIVPEGLPYRHSCEGPDDMPAHVKACFLGSSLTIPITDGKLSLGTWQGVWLCEHRDQAGSRKLVI 168
            |||||...|||:.||.||||||||:..:|.|||:|||:|||||||||.:.|.|.|.|..||.:|.
pombe    70 KIVPESAGYRHTAEGLDDMPAHVKSSLIGPSLTVPITNGKLSLGTWQDIQLAEFRRQPHSRTIVC 134

  Fly   169 TLTG 172
            |:.|
pombe   135 TIIG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31688NP_610035.4 UPF0047 53..170 CDD:280133 63/116 (54%)
SPAC4A8.02cNP_593813.1 YjbQ 1..138 CDD:223509 69/132 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1285
eggNOG 1 0.900 - - E1_COG0432
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15469
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009957
OrthoInspector 1 1.000 - - oto101486
orthoMCL 1 0.900 - - OOG6_101441
Panther 1 1.100 - - LDO PTHR30615
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16838
SonicParanoid 1 1.000 - - X7631
TreeFam 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.