DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15130 and Tmie

DIOPT Version :10

Sequence 1:NP_610034.2 Gene:CG15130 / 35312 FlyBaseID:FBgn0032860 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_036010653.1 Gene:Tmie / 20776 MGIID:2159400 Length:195 Species:Mus musculus


Alignment Length:76 Identity:21/76 - (27%)
Similarity:38/76 - (50%) Gaps:16/76 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MIMVCCCIRFRIPRTKQEIEADYQRKQITKKFREKLQQI--------------KNSEMDDMDLQK 88
            :|.:||....|:|||::||||.|.:::..|.:.:||:.:              |..:.|.:|  .
Mouse   114 VITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEIPGEDKKKKKKDSVD--T 176

  Fly    89 VCARIQSDYLN 99
            |..:::.|..|
Mouse   177 VAIKVEEDEKN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15130NP_610034.2 TMIE 13..97 CDD:464987 19/72 (26%)
TmieXP_036010653.1 TMIE <114..174 CDD:464987 17/59 (29%)

Return to query results.
Submit another query.